Tested Applications
| Positive WB detected in | HCT 116 cells, U-251 cells, HEK-293T cells |
| Positive IF/ICC detected in | HeLa cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:3000 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
28671-1-AP targets RFC5 in WB, IF/ICC, ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag29236 Product name: Recombinant human RFC5 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 219-341 aa of BC001866 Sequence: ILQSTNMAFGKVTEETVYTCTGHPLKSDIANILDWMLNQDFTTAYRNITELKTLKGLALHDILTEIHLFVHRVDFPSSVRIHLLTKMADIEYRLSVGTNEKIQLSSLIAAFQVTRDLIVAEA Predict reactive species |
| Full Name | replication factor C (activator 1) 5, 36.5kDa |
| Calculated Molecular Weight | 38 kDa |
| Observed Molecular Weight | 38 kDa |
| GenBank Accession Number | BC001866 |
| Gene Symbol | RFC5 |
| Gene ID (NCBI) | 5985 |
| RRID | AB_2918189 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P40937 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Replication factor C subunit 5 (RFC5), also known as activator 1, can recruit proliferating cell nuclear antigen(PCNA) onto the DNA polymerase S-phase checkpoint complex. In eukaryotes, RFC5 is involved in repairing mismatches, DNA double helix damage, nucleotide excision, and regulating the cell cycle(PMID: 30210909). RFC5 is significantly upregulated in cancer tissues or cells, and its expression is elevated with the cancer progression(PMID: 30214556).
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for RFC5 antibody 28671-1-AP | Download protocol |
| WB protocol for RFC5 antibody 28671-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |





