PPARGC1B Monoclonal antibody, PBS Only

• 

  WB analysis using 67821-1-Ig (same clone as 67821-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 67821-1-Ig (PPARGC1B antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67821-1-PBS in a different storage buffer formulation.

• 

  WB analysis of SH-SY5Y using 67821-1-Ig (same clone as 67821-1-PBS)

  SH-SY5Y cells were subjected to SDS PAGE followed by western blot with 67821-1-Ig (PPARGC1B antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67821-1-PBS in a different storage buffer formulation.

• 

  WB analysis of pig brain using 67821-1-Ig (same clone as 67821-1-PBS)

  pig brain tissue were subjected to SDS PAGE followed by western blot with 67821-1-Ig (PPARGC1B antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67821-1-PBS in a different storage buffer formulation.

• 

  WB analysis of rat brain using 67821-1-Ig (same clone as 67821-1-PBS)

  rat brain tissue were subjected to SDS PAGE followed by western blot with 67821-1-Ig (PPARGC1B antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67821-1-PBS in a different storage buffer formulation.

• 

  WB analysis of mouse brain using 67821-1-Ig (same clone as 67821-1-PBS)

  mouse brain tissue were subjected to SDS PAGE followed by western blot with 67821-1-Ig (PPARGC1B antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67821-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HeLa using 67821-1-Ig (same clone as 67821-1-PBS)

  HeLa cells were subjected to SDS PAGE followed by western blot with 67821-1-Ig (PPARGC1B antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67821-1-PBS in a different storage buffer formulation.

• 

  WB analysis of MCF-7 using 67821-1-Ig (same clone as 67821-1-PBS)

  MCF-7 cells were subjected to SDS PAGE followed by western blot with 67821-1-Ig (PPARGC1B antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67821-1-PBS in a different storage buffer formulation.

PPARGC1B Monoclonal Antibody for WB, Indirect ELISA

Cat No. 67821-1-PBS

Clone No.2D2E8

Host / Isotype

Mouse / IgG1

Reactivity

Human, mouse, pig, rat

Applications

WB, Indirect ELISA

Synonyms

ERRL1, PERC, PGC 1 beta, PGC 1(beta), PGC1, PGC1B, PPAR gamma coactivator 1 beta, PPARGC 1 beta, PPARGC1, PPARGC1B

---

Product Information

67821-1-PBS targets PPARGC1B in WB, Indirect ELISA applications and shows reactivity with Human, mouse, pig, rat samples.

• Tested Reactivity: Human, mouse, pig, rat
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag28861

  Product name: Recombinant human PPARGC1B protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-350 aa of BC132971

  Sequence: MAGNDCGALLDEELSSFFLNYLADTQGGGSGEEQLYADFPELDLSQLDASDFDSATCFGELQWCPENSETEPNQYSPDDSELFQIDSENEALLAELTKTLDDIPEDDVGLAAFPALDGGDALSCTSASPAPSSAPPSPAPEKPSAPAPEVDELSLLQKLLLATSYPTSSSDTQKEGTAWRQAGLRSKSQRPCVKADSTQDKKAPMMQSQSRSCTELHKHLTSAQCCLQDRGLQPPCLQSPRLPAKEDKEPGEDCPSPQPAPASPRDSLALGRADPGAPVSQEDMQAMVQLIRYMHTYCLPQRKLPPQTPEPLPKACSNPSQQVRSRPWSRHHSKASWAEFSILRELLAQD

• Full Name: peroxisome proliferator-activated receptor gamma, coactivator 1 beta
• Calculated Molecular Weight: 1023 aa, 113 kDa
• Observed Molecular Weight: 150 kDa
• GenBank Accession Number: BC132971
• Gene Symbol: PPARGC1B
• Gene ID (NCBI): 133522
• RRID: AB_2918584
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: Q86YN6
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.