PPARGC1B Monoclonal antibody

• 

  WB analysis using 67821-1-Ig

  Various lysates were subjected to SDS PAGE followed by western blot with 67821-1-Ig (PPARGC1B antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of SH-SY5Y using 67821-1-Ig

  SH-SY5Y cells were subjected to SDS PAGE followed by western blot with 67821-1-Ig (PPARGC1B antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of pig brain using 67821-1-Ig

  pig brain tissue were subjected to SDS PAGE followed by western blot with 67821-1-Ig (PPARGC1B antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of rat brain using 67821-1-Ig

  rat brain tissue were subjected to SDS PAGE followed by western blot with 67821-1-Ig (PPARGC1B antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of mouse brain using 67821-1-Ig

  mouse brain tissue were subjected to SDS PAGE followed by western blot with 67821-1-Ig (PPARGC1B antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HeLa using 67821-1-Ig

  HeLa cells were subjected to SDS PAGE followed by western blot with 67821-1-Ig (PPARGC1B antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of MCF-7 using 67821-1-Ig

  MCF-7 cells were subjected to SDS PAGE followed by western blot with 67821-1-Ig (PPARGC1B antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.

PPARGC1B Monoclonal Antibody for WB, ELISA

Cat No. 67821-1-Ig

Clone No.2D2E8

Publications(2)

Host / Isotype

Mouse / IgG1

Reactivity

Human, mouse, pig, rat

Applications

WB, ELISA

Synonyms

ERRL1, PERC, PGC 1 beta, PGC 1(beta), PGC1, PGC1B, PPAR gamma coactivator 1 beta, PPARGC 1 beta, PPARGC1, PPARGC1B

---

Tested Applications

• Positive WB detected in: HeLa cells, MCF-7 cells, SH-SY5Y cells, pig brain tissue, rat brain tissue, mouse brain tissue

Recommended dilution

• Western Blot (WB): WB : 1:2000-1:10000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 2 publications below

Product Information

67821-1-Ig targets PPARGC1B in WB, ELISA applications and shows reactivity with Human, mouse, pig, rat samples.

• Tested Reactivity: Human, mouse, pig, rat
• Cited Reactivity: mouse, rat
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag28861

  Product name: Recombinant human PPARGC1B protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-350 aa of BC132971

  Sequence: MAGNDCGALLDEELSSFFLNYLADTQGGGSGEEQLYADFPELDLSQLDASDFDSATCFGELQWCPENSETEPNQYSPDDSELFQIDSENEALLAELTKTLDDIPEDDVGLAAFPALDGGDALSCTSASPAPSSAPPSPAPEKPSAPAPEVDELSLLQKLLLATSYPTSSSDTQKEGTAWRQAGLRSKSQRPCVKADSTQDKKAPMMQSQSRSCTELHKHLTSAQCCLQDRGLQPPCLQSPRLPAKEDKEPGEDCPSPQPAPASPRDSLALGRADPGAPVSQEDMQAMVQLIRYMHTYCLPQRKLPPQTPEPLPKACSNPSQQVRSRPWSRHHSKASWAEFSILRELLAQD

• Full Name: peroxisome proliferator-activated receptor gamma, coactivator 1 beta
• Calculated Molecular Weight: 1023 aa, 113 kDa
• Observed Molecular Weight: 150 kDa
• GenBank Accession Number: BC132971
• Gene Symbol: PPARGC1B
• Gene ID (NCBI): 133522
• RRID: AB_2918584
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: Q86YN6
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
rat	WB	Chem Biol Interact; N-acetylcysteine delayed cadmium-induced chronic kidney injury by activating the sirtuin 1-P53 signaling pathway; Authors - Wenxuan Dong
mouse	WB	Sci Rep; Dietary oleic acid intake increases the proportion of type 1 and 2X muscle fibers in mice; Authors - Yusuke Komiya