• Featured Product
  • KD/KO Validated

CoraLite® Plus 488-conjugated PKC Iota Monoclonal antibody

PKC Iota Monoclonal Antibody for IF/ICC, FC (Intra)
Cat No. CL488-66493
Clone No.3A1B6

Host / Isotype

Mouse / IgG2a

Reactivity

human, mouse, rat

Applications

IF/ICC, FC (Intra)

PRKCI, 3A1B6, aPKC lambda/iota, aPKC-lambda/iota, Atypical protein kinase C-lambda/iota

Formulation:  PBS, Proclin 300, BSA, Glycerol
PBS, Proclin 300, BSA, Glycerol
Conjugate:  CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IF/ICC detected inHeLa cells
Positive FC (Intra) detected inHeLa cells

Recommended dilution

ApplicationDilution
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.80 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL488-66493 targets PKC Iota in IF/ICC, FC (Intra) applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Mouse / IgG2a
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag4990

Product name: Recombinant human PRKCI protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 238-587 aa of BC022016

Sequence: SSLGLQDFDLLRVIGRGSYAKVLLVRLKKTDRIYAMKVVKKELVNDDEDIDWVQTEKHVFEQASNHPFLVGLHSCFQTESRLFFVIEYVNGGDLMFHMQRQRKLPEEHARFYSAEISLALNYLHERGIIYRDLKLDNVLLDSEGHIKLTDYGMCKEGLRPGDTTSTFCGTPNYIAPEILRGEDYGFSVDWWALGVLMFEMMAGRSPFDIVGSSDNPDQNTEDYLFQVILEKQIRIPRSMSVKAASVLKSFLNKDPKERLGCLPQTGFADIQGHPFFRNVDWDMMEQKQVVPPFKPNISGEFGLDNFDSQFTNERVQLTPDDDDIVRKIDQSEFEGFEYINPLLMSAEECV

Predict reactive species
Full Name protein kinase C, iota
Calculated Molecular Weight 68 kDa
GenBank Accession NumberBC022016
Gene Symbol PKC Iota
Gene ID (NCBI) 5584
RRIDAB_2883348
Conjugate CoraLite® Plus 488 Fluorescent Dye
Excitation/Emission Maxima Wavelengths493 nm / 522 nm
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP41743
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

The atypical protein kinase C isoform PRKC iota (PRKCI) is a member of the protein kinase C (PKC) family of serine/threonine protein kinases. PKC family comprises at least eight members, which are differentially expressed and are involved in a wide variety of cellular processes. PRKC iota is calcium-independent and phospholipid-dependent. It is not activated by phorbolesters or diacylglycerol. This kinase can be recruited to vesicle tubular clusters (VTCs) by direct interaction with the small GTPase RAB2, where this kinase phosphorylates glyceraldehyde-3-phosphate dehydrogenase (GAPD/GAPDH) and plays a role in microtubule dynamics in the early secretory pathway. This kinase is found to be necessary for BCL-ABL-mediated resistance to drug-induced apoptosis and therefore protects leukemia cells against drug-induced apoptosis. PRKC iota plays a key role in cell proliferation, differentiation, and carcinogenesis, and it has been shown to be a human oncogene.

Protocols

Product Specific Protocols
IF protocol for CL Plus 488 PKC Iota antibody CL488-66493Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...