Tested Applications
| Positive IF/ICC detected in | HeLa cells |
| Positive FC (Intra) detected in | HeLa cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
| Flow Cytometry (FC) (INTRA) | FC (INTRA) : 0.80 ug per 10^6 cells in a 100 µl suspension |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
CL488-66493 targets PKC Iota in IF/ICC, FC (Intra) applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Host / Isotype | Mouse / IgG2a |
| Class | Monoclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag4990 Product name: Recombinant human PRKCI protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 238-587 aa of BC022016 Sequence: SSLGLQDFDLLRVIGRGSYAKVLLVRLKKTDRIYAMKVVKKELVNDDEDIDWVQTEKHVFEQASNHPFLVGLHSCFQTESRLFFVIEYVNGGDLMFHMQRQRKLPEEHARFYSAEISLALNYLHERGIIYRDLKLDNVLLDSEGHIKLTDYGMCKEGLRPGDTTSTFCGTPNYIAPEILRGEDYGFSVDWWALGVLMFEMMAGRSPFDIVGSSDNPDQNTEDYLFQVILEKQIRIPRSMSVKAASVLKSFLNKDPKERLGCLPQTGFADIQGHPFFRNVDWDMMEQKQVVPPFKPNISGEFGLDNFDSQFTNERVQLTPDDDDIVRKIDQSEFEGFEYINPLLMSAEECV Predict reactive species |
| Full Name | protein kinase C, iota |
| Calculated Molecular Weight | 68 kDa |
| GenBank Accession Number | BC022016 |
| Gene Symbol | PKC Iota |
| Gene ID (NCBI) | 5584 |
| RRID | AB_2883348 |
| Conjugate | CoraLite® Plus 488 Fluorescent Dye |
| Excitation/Emission Maxima Wavelengths | 493 nm / 522 nm |
| Form | Liquid |
| Purification Method | Protein A purification |
| UNIPROT ID | P41743 |
| Storage Buffer | PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3. |
| Storage Conditions | Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. |
Background Information
The atypical protein kinase C isoform PRKC iota (PRKCI) is a member of the protein kinase C (PKC) family of serine/threonine protein kinases. PKC family comprises at least eight members, which are differentially expressed and are involved in a wide variety of cellular processes. PRKC iota is calcium-independent and phospholipid-dependent. It is not activated by phorbolesters or diacylglycerol. This kinase can be recruited to vesicle tubular clusters (VTCs) by direct interaction with the small GTPase RAB2, where this kinase phosphorylates glyceraldehyde-3-phosphate dehydrogenase (GAPD/GAPDH) and plays a role in microtubule dynamics in the early secretory pathway. This kinase is found to be necessary for BCL-ABL-mediated resistance to drug-induced apoptosis and therefore protects leukemia cells against drug-induced apoptosis. PRKC iota plays a key role in cell proliferation, differentiation, and carcinogenesis, and it has been shown to be a human oncogene.
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for CL Plus 488 PKC Iota antibody CL488-66493 | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |





