CoraLite® Plus 488-conjugated PKC Iota Polyclonal antibody

• 

  IF Staining of HeLa using CL488-13883

  Immunofluorescent analysis of (-20°C Ethanol) fixed HeLa cells using CoraLite® Plus 488 PKC Iota antibody (CL488-13883) at dilution of 1:200.

• 

  FC experiment of HeLa using CL488-13883

  1x10^6 HeLa cells were intracellularly stained with 0.8 ug CoraLite® Plus 488 Anti-Human PKC Iota (CL488-13883) (red), or 0.8 ug CoraLite® Plus 488-conjugated Rabbit IgG control Rabbit PolyAb (CL488-30000, Clone: ) (blue). Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer (PF00011-C).

• Featured Product
• KD/KO Validated

PKC Iota Polyclonal Antibody for IF/ICC, FC (Intra)

Cat No. CL488-13883

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

IF/ICC, FC (Intra)

Synonyms

PRKCI, nPKC-iota, EC:2.7.11.13, DXS1179E, Atypical protein kinase C-lambda/iota

---

Tested Applications

• Positive IF/ICC detected in: HeLa cells
• Positive FC (Intra) detected in: HeLa cells

Recommended dilution

• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500
• Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.80 ug per 10^6 cells in a 100 µl suspension

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

CL488-13883 targets PKC Iota in IF/ICC, FC (Intra) applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag4990

  Product name: Recombinant human PRKCI protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 238-587 aa of BC022016

  Sequence: SSLGLQDFDLLRVIGRGSYAKVLLVRLKKTDRIYAMKVVKKELVNDDEDIDWVQTEKHVFEQASNHPFLVGLHSCFQTESRLFFVIEYVNGGDLMFHMQRQRKLPEEHARFYSAEISLALNYLHERGIIYRDLKLDNVLLDSEGHIKLTDYGMCKEGLRPGDTTSTFCGTPNYIAPEILRGEDYGFSVDWWALGVLMFEMMAGRSPFDIVGSSDNPDQNTEDYLFQVILEKQIRIPRSMSVKAASVLKSFLNKDPKERLGCLPQTGFADIQGHPFFRNVDWDMMEQKQVVPPFKPNISGEFGLDNFDSQFTNERVQLTPDDDDIVRKIDQSEFEGFEYINPLLMSAEECV

• Full Name: protein kinase C, iota
• Calculated Molecular Weight: 68 kDa
• GenBank Accession Number: BC022016
• Gene Symbol: PKC Iota
• Gene ID (NCBI): 5584
• RRID: AB_2919080
• Conjugate: CoraLite® Plus 488 Fluorescent Dye
• Excitation/Emission Maxima Wavelengths: 493 nm / 522 nm
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P41743
• Storage Buffer: PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
• Storage Conditions: Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage.