• Featured Product
  • KD/KO Validated

CoraLite® Plus 488-conjugated PD-L1/CD274 Monoclonal antibody

PD-L1/CD274 Monoclonal Antibody for IF-P
Cat No. CL488-66248
Clone No.2B11D11

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse, pig, rat

Applications

IF-P

B7 H, B7 H1, B7 homolog 1, B7H1, CD274, CD274 molecule, PD L1, PDCD1 ligand 1, PDCD1L1, PDCD1LG1, PDL1, PD-L1/CD274, Programmed death ligand 1

Formulation:  PBS and Azide
PBS and Azide
Conjugate:  CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IF-P detected inhuman placenta tissue

Recommended dilution

ApplicationDilution
Immunofluorescence (IF)-PIF-P : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL488-66248 targets PD-L1/CD274 in IF-P applications and shows reactivity with human, mouse, pig, rat samples.

Tested Reactivity human, mouse, pig, rat
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag12443

Product name: Recombinant human PD-L1/CD274 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 25-241 aa of BC074984

Sequence: KDLYVVEYGSNMTIECKFPVEKQLDLAALIVYWEMEDKNIIQFVHGEEDLKVQHSSYRQRARLLKDQLSLGNAALQITDVKLQDAGVYRCMISYGGADYKRITVKVNAPYNKINQRILVVDPVTSEHELTCQAEGYPKAEVIWTSSDHQVLSGKTTTTNSKREEKLFNVTSTLRINTTTNEIFYCTFRRLDPEENHTAELVIPELPLAHPPNERTHL

Predict reactive species
Full Name CD274 molecule
Calculated Molecular Weight 290 aa, 33 kDa
Observed Molecular Weight 50 kDa
GenBank Accession NumberBC074984
Gene Symbol PD-L1
Gene ID (NCBI) 29126
RRIDAB_3672908
Conjugate CoraLite® Plus 488 Fluorescent Dye
Excitation/Emission Maxima Wavelengths493 nm / 522 nm
FormLiquid
Purification MethodProtein G purification
UNIPROT IDQ9NZQ7
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

Programmed cell death ligand 1 (PD-L1, CD274, or B7-H1), is the first member of B7 family to be discovered. B7 family molecules are type I transmembrane proteins belonging to the immunoglobulin superfamily. In concert with their CD28 family receptors, the B7s are key regulators of the adaptive immune response. PD-L1 is suggested as a negative regulator of T and B cell, and plays important role in mediating tolerance of lymphocytes to self-antigens. It is also involved in the costimulatory signal, essential for T-cell proliferation and production of IL10 and IFNG, in an IL2-dependent and a PD-1-independent manner.

Protocols

Product Specific Protocols
IF protocol for CL Plus 488 PD-L1/CD274 antibody CL488-66248Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...