CoraLite® Plus 488-conjugated PD-L1/CD274 Monoclonal antibody

• 

  IF Staining of human placenta using CL488-66248

  Immunofluorescent analysis of (4% PFA) fixed paraffin-embedded human placenta tissue using CoraLite® Plus 488 PD-L1/CD274 antibody (CL488-66248, Clone: 2B11D11 ) at dilution of 1:200. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• Featured Product
• KD/KO Validated

PD-L1/CD274 Monoclonal Antibody for IF-P

Cat No. CL488-66248

Clone No.2B11D11

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse, pig, rat

Applications

IF-P

Synonyms

B7 H, B7 H1, B7 homolog 1, B7H1, CD274, CD274 molecule, PD L1, PDCD1 ligand 1, PDCD1L1, PDCD1LG1, PDL1, PD-L1/CD274, Programmed death ligand 1

---

Tested Applications

• Positive IF-P detected in: human placenta tissue

Recommended dilution

• Immunofluorescence (IF)-P: IF-P : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

CL488-66248 targets PD-L1/CD274 in IF-P applications and shows reactivity with human, mouse, pig, rat samples.

• Tested Reactivity: human, mouse, pig, rat
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag12443

  Product name: Recombinant human PD-L1/CD274 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 25-241 aa of BC074984

  Sequence: KDLYVVEYGSNMTIECKFPVEKQLDLAALIVYWEMEDKNIIQFVHGEEDLKVQHSSYRQRARLLKDQLSLGNAALQITDVKLQDAGVYRCMISYGGADYKRITVKVNAPYNKINQRILVVDPVTSEHELTCQAEGYPKAEVIWTSSDHQVLSGKTTTTNSKREEKLFNVTSTLRINTTTNEIFYCTFRRLDPEENHTAELVIPELPLAHPPNERTHL

• Full Name: CD274 molecule
• Calculated Molecular Weight: 290 aa, 33 kDa
• Observed Molecular Weight: 50 kDa
• GenBank Accession Number: BC074984
• Gene Symbol: PD-L1
• Gene ID (NCBI): 29126
• RRID: AB_3672908
• Conjugate: CoraLite® Plus 488 Fluorescent Dye
• Excitation/Emission Maxima Wavelengths: 493 nm / 522 nm
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: Q9NZQ7
• Storage Buffer: PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
• Storage Conditions: Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage.

Background Information

Programmed cell death ligand 1 (PD-L1, CD274, or B7-H1), is the first member of B7 family to be discovered. B7 family molecules are type I transmembrane proteins belonging to the immunoglobulin superfamily. In concert with their CD28 family receptors, the B7s are key regulators of the adaptive immune response. PD-L1 is suggested as a negative regulator of T and B cell, and plays important role in mediating tolerance of lymphocytes to self-antigens. It is also involved in the costimulatory signal, essential for T-cell proliferation and production of IL10 and IFNG, in an IL2-dependent and a PD-1-independent manner.