• Featured Product
  • KD/KO Validated

HRP-conjugated PCNA Monoclonal antibody

PCNA Monoclonal Antibody for WB
Cat No. HRP-60097
Clone No.10D10E11

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse, pig, rat

Applications

WB

Cyclin, PCNA

Formulation:  PBS, Proclin 300, BSA, Glycerol
PBS, Proclin 300, BSA, Glycerol
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inHEK-293 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:5000-1:50000
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Published Applications

WBSee 2 publications below

Product Information

HRP-60097 targets PCNA in WB applications and shows reactivity with human, mouse, pig, rat samples.

Tested Reactivity human, mouse, pig, rat
Cited Reactivityhuman, mouse
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag7416

Product name: Recombinant human PCNA protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 8-256 aa of BC000491

Sequence: QGSILKKVLEALKDLINEACWDISSSGVNLQSMDSSHVSLVQLTLRSEGFDTYRCDRNLAMGVNLTSMSKILKCAGNEDIITLRAEDNADTLALVFEAPNQEKVSDYEMKLMDLDVEQLGIPEQEYSCVVKMPSGEFARICRDLSHIGDAVVISCAKDGVKFSASGELGNGNIKLSQTSNVDKEEEAVTIEMNEPVQLTFALRYLNFFTKATPLSSTVTLSMSADVPLVVEYKIADMGHLKYYLAPKIE

Predict reactive species
Full Name proliferating cell nuclear antigen
Calculated Molecular Weight 29 kDa/31 kDa
Observed Molecular Weight 36-38 kDa
GenBank Accession NumberBC000491
Gene Symbol PCNA
Gene ID (NCBI) 5111
RRIDAB_2883829
Conjugate HRP
FormLiquid
Purification MethodProtein G purification
UNIPROT IDP12004
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

Proliferating Cell Nuclear Antigen, commonly known as PCNA, is a protein that acts as a processivity factor for DNA polymerase δ in eukaryotic cells. This protein is an auxiliary protein of DNA polymerase delta and is involved in the control of eukaryotic DNA replication by increasing the polymerase's processibility during elongation of the leading strand. PCNA induces a robust stimulatory effect on the 3'-5' exonuclease and 3'-phosphodiesterase, but not apurinic-apyrimidinic (AP) endonuclease, APEX2 activities. It has to be loaded onto DNA in order to be able to stimulate APEX2. PCNA protein is highly conserved during evolution; the deduced amino acid sequences of rat and human differ by only 4 of 261 amino acids. PCNA has been used as loading control for proliferating cells. The calculated molecular weight of PCNA is 29 kDa, but modified PCNA is 36kDa (PMID: 1358458).

Protocols

Product Specific Protocols
WB protocol for HRP PCNA antibody HRP-60097Download protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
humanWB

Phytother Res

Bergapten Ameliorates Psoriatic Skin Lesions and IL-17A-Induced Activation of the NF-κB Signaling Pathway via the Downregulation of CYP1B1

Authors - Shengjie Zhu
mouseWB

Mol Reprod Dev

The transcription factors Junb and Fosl2 cooperate to regulate Cdh3 expression in 15P-1 Sertoli cells

Authors - Ha T Nguyen

Front Physiol

Metamizole does not affect fracture healing in a murine ischemia model

Authors - Christian Schönbeck

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


FH

Alexandra (Verified Customer) (07-03-2024)

Works properly with endogenous protein and overexpressed protein from plasmid as well.

  • Applications: Western Blot, Immunofluorescence
  • Primary Antibody Dilution: 1000x
  • Cell Tissue Type: U2OS human osteosarcoma cell line
HRP PCNA Antibody Western Blot,Immunofluorescence validation (1000x dilution) in U2OS human osteosarcoma cell line (Cat no:HRP-60097)
Loading...
||
New chat

Able

正在加载,请稍候...