• Featured Product
  • KD/KO Validated

PARK2/Parkin Polyclonal antibody

PARK2/Parkin Polyclonal Antibody for WB, IHC, IF/ICC, IF-P, ELISA

Cat No. 14060-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat and More (7)

Applications

WB, IHC, IF/ICC, IF-P, IP, CoIP, ELISA

PARK2, Parkin, E3 ubiquitin-protein ligase parkin, EC:2.3.2.31, Parkin RBR E3 ubiquitin-protein ligase

Formulation:  PBS and Azide
PBS and Azide
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inC6 cells, HEK-293 cells, mouse liver tissue, PC-12 cells
Positive IHC detected inmouse kidney tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF-P detected inmouse heart tissue, mouse brain tissue
Positive IF/ICC detected inRAW 264.7 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:1000-1:4000
Immunohistochemistry (IHC)IHC : 1:50-1:500
Immunofluorescence (IF)-PIF-P : 1:50-1:500
Immunofluorescence (IF)/ICCIF/ICC : 1:200-1:800
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

14060-1-AP targets PARK2/Parkin in WB, IHC, IF/ICC, IF-P, IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Cited Reactivityhuman, mouse, rat, pig, rabbit, monkey, chicken, bovine, cattle, ducks
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag5092

Product name: Recombinant human Parkin protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 81-387 aa of BC022014

Sequence: NATGGDDPRNAAGGCEREPQSLTRVDLSSSVLPGDSVGLAVILHTDSRKDSPPAGSPAGRSIYNSFYVYCKGPCQRVQPGKLRVQCSTCRQATLTLTQGPSCWDDVLIPNRMSGECQSPHCPGTSAEFFFKCGAHPTSDKETSVALHLIATNSRNITCITCTDVRSPVLVFQCNSRHVICLDCFHLYCVTRLNDRQFVHDPQLGYSLPCVGTGDTVVLRGALGGFRRGVAGCPNSLIKELHHFRILGEEQYNRYQQYGAEECVLQMGGVLCPRPGCGAGLLPEPDQRKVTCEGGNGLGCGYGQRRTK

Predict reactive species
Full Name Parkinson disease (autosomal recessive, juvenile) 2, parkin
Calculated Molecular Weight 52 kDa
Observed Molecular Weight 42-52 kDa
GenBank Accession NumberBC022014
Gene Symbol Parkin
Gene ID (NCBI) 5071
RRIDAB_2878005
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDO60260
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Parkin, a RING-type E3 ubiquitin-protein ligase, is involved in the ubiquitination pathway and contributes to protection from neurotoxicity induced by unfolded protein stresses. Its ubiquitin-protein ligase activity promotes the degradation of a variety of proteins including itself. Mutations in Parkin are implicated in the pathogenesis of autosomal recessive familial Parkinson's disease. It has 8 isoforms produced by alternative splicing with molecular weights of 24, 31, 36 and 42-52 kDa. Sometimes an additional band of 70 kDa or 110 kDa may be detected, which is caused by ubiquitination modification or formation of Parkin complex (PMID: 10976934, PMID: 18190519).

Protocols

Product Specific Protocols
WB protocol for PARK2/Parkin antibody 14060-1-APDownload protocol
IHC protocol for PARK2/Parkin antibody 14060-1-APDownload protocol
IF protocol for PARK2/Parkin antibody 14060-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
mouseWB

Nat Cell Biol

Ammonia-induced lysosomal and mitochondrial damage causes cell death of effector CD8+ T cells

Authors - Huafeng Zhang
WB

Nat Commun

Augmented temperature fluctuation aggravates muscular atrophy through the gut microbiota

Authors - Ya Liu
humanIF

Mol Cell

The HRI branch of the integrated stress response selectively triggers mitophagy

Authors - Yogaditya Chakrabarty
humanWB

Acta Pharm Sin B

Histone deacetylase inhibitors inhibit cervical cancer growth through Parkin acetylation-mediated mitophagy.

Authors - Xin Sun
mouseWB

Acta Pharm Sin B

Engineering cannabidiol synergistic carbon monoxide nanocomplexes to enhance cancer therapy via excessive autophagy

Authors - Chang Xiao
humanWB

Autophagy

Increased mitochondrial fission promotes autophagy and hepatocellular carcinoma cell survival through the ROS-modulated coordinated regulation of the NFKB and TP53 pathways.

Authors - Qichao Huang

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


FH

Javier (Verified Customer) (09-09-2025)

Perfect antibody for western blotting assay.

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:1000
  • Cell Tissue Type: Mice kidneys
FH

QX (Verified Customer) (05-08-2025)

It is okay to detect endogenous PARK2 with the right around 52 kd MW although there are some nonspecific bands,

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:1000
  • Cell Tissue Type: mouse brain lysate
PARK2/Parkin Antibody Western Blot validation (1:1000 dilution) in mouse brain lysate (Cat no:14060-1-AP)
FH

Ajte (Verified Customer) (03-08-2022)

It works well for me

  • Applications: Western Blot
FH

Elyssa (Verified Customer) (11-11-2019)

This antibody worked well for me for one cell line (I had tried detecting the protein in 3 cells lines, and only one cell line appeared to have expression. However, I have not looked into this further and cannot say if this has to do with the antibody, or differential expression across lines). Overall, I was happy with the antibody.

  • Applications: Western Blot,
  • Primary Antibody Dilution: 1:1000
  • Cell Tissue Type: T47D, MCF7, CAMA1 (only worked in T47D)
Loading...