CoraLite® Plus 488-conjugated PABPC4 Polyclonal antibody

• 

  IF Staining of HeLa using CL488-14960

  Immunofluorescent analysis of (-20°C Ethanol) fixed HeLa cells using CoraLite® Plus 488 PABPC4 antibody (CL488-14960) at dilution of 1:200.

• 

  IF Staining of HepG2 using CL488-14960

  Immunofluorescent analysis of (-20°C Ethanol) fixed HepG2 cells using CoraLite® Plus 488 PABPC4 antibody (CL488-14960) at dilution of 1:400.

• Featured Product
• KD/KO Validated

PABPC4 Polyclonal Antibody for IF/ICC

Cat No. CL488-14960

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

IF/ICC

Synonyms

Inducible poly(A)-binding protein, APP-1, APP1, APP 1, Activated-platelet protein 1

---

Tested Applications

• Positive IF/ICC detected in: HepG2 cells, HeLa cells

Recommended dilution

• Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

CL488-14960 targets PABPC4 in IF/ICC applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag6813

  Product name: Recombinant human PABPC4 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 285-631 aa of BC065540

  Sequence: QERISRYQGVNLYIKNLDDTIDDEKLRKEFSPFGSITSAKVMLEDGRSKGFGFVCFSSPEEATKAVTEMNGRIVGSKPLYVALAQRKEERKAHLTNQYMQRVAGMRALPANAILNQFQPAAGGYFVPAVPQAQGRPPYYTPNQLAQMRPNPRWQQGGRPQGFQGMPSAIRQSGPRPTLRHLAPTGNAPASRGLPTTTQRVGVPTAVQNLAPRAAVAAAAPRAVAPYKYASSVRSPHPAIQPLQAPQPAVHVQGQEPLTASMLAAAPPQEQKQMLGERLFPLIQTMHSNLAGKITGMLLEIDNSELLHMLESPESLRSKVDEAVAVLQAHHAKKEAAQKVGAVAAATS

• Full Name: poly(A) binding protein, cytoplasmic 4 (inducible form)
• Calculated Molecular Weight: 70 kDa
• Observed Molecular Weight: 70-71 kDa
• GenBank Accession Number: BC065540
• Gene Symbol: PABPC4
• Gene ID (NCBI): 8761
• RRID: AB_3083966
• Conjugate: CoraLite® Plus 488 Fluorescent Dye
• Excitation/Emission Maxima Wavelengths: 493 nm / 522 nm
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q13310
• Storage Buffer: PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
• Storage Conditions: Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage.