- Home
- Products
- Primary Antibodies
- P53 Monoclonal antibody, PBS Only (Capture/Detector) (60283-2-PBS)
Proteintech Guarantee
The Proteintech guarantee covers Proteintech antibodies in any species and any application, including those not listed on the datasheet. If the antibody doesn’t perform, you can receive a hassle-free refund or credit note.
WB analysis using 60283-2-Ig (same clone as 60283-2-PBS)
Various lysates were subjected to SDS PAGE followed by western blot with 60283-2-Ig (P53 antibody) at dilution of 1:20000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 60283-2-PBS in a different storage buffer formulation.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy× Various lysates were subjected to SDS PAGE followed by western blot with 60283-2-Ig (P53 antibody) at dilution of 1:20000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 60283-2-PBS in a different storage buffer formulation.
WB analysis using 60283-2-Ig (same clone as 60283-2-PBS)
Various lysates were subjected to SDS PAGE followed by western blot with 60283-2-Ig (P53 antibody) at dilution of 1:50000 incubated at room temperature for 1.5 hours. The membrane was stripped and reblotted with GAPDH antibody HRP-60004 as loading control. Negative control: SKOV-3 cells, Saos-2 cells. This data was developed using the same antibody clone with 60283-2-PBS in a different storage buffer formulation.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy× Various lysates were subjected to SDS PAGE followed by western blot with 60283-2-Ig (P53 antibody) at dilution of 1:50000 incubated at room temperature for 1.5 hours. The membrane was stripped and reblotted with GAPDH antibody HRP-60004 as loading control. Negative control: SKOV-3 cells, Saos-2 cells. This data was developed using the same antibody clone with 60283-2-PBS in a different storage buffer formulation.
WB analysis of HSC-T6 using 60283-2-Ig (same clone as 60283-2-PBS)
HSC-T6 cells were subjected to SDS PAGE followed by western blot with 60283-2-Ig (P53 antibody) at dilution of 1:20000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 60283-2-PBS in a different storage buffer formulation.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy× HSC-T6 cells were subjected to SDS PAGE followed by western blot with 60283-2-Ig (P53 antibody) at dilution of 1:20000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 60283-2-PBS in a different storage buffer formulation.
WB analysis of ROS1728 using 60283-2-Ig (same clone as 60283-2-PBS)
ROS1728 cells were subjected to SDS PAGE followed by western blot with 60283-2-Ig (P53 antibody) at dilution of 1:20000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 60283-2-PBS in a different storage buffer formulation.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy× ROS1728 cells were subjected to SDS PAGE followed by western blot with 60283-2-Ig (P53 antibody) at dilution of 1:20000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 60283-2-PBS in a different storage buffer formulation.
WB analysis of rat thymus using 60283-2-Ig (same clone as 60283-2-PBS)
rat thymus tissue were subjected to SDS PAGE followed by western blot with 60283-2-Ig (P53 antibody) at dilution of 1:20000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 60283-2-PBS in a different storage buffer formulation.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy× rat thymus tissue were subjected to SDS PAGE followed by western blot with 60283-2-Ig (P53 antibody) at dilution of 1:20000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 60283-2-PBS in a different storage buffer formulation.
WB analysis of COLO 320 using 60283-2-Ig (same clone as 60283-2-PBS)
COLO 320 cells were subjected to SDS PAGE followed by western blot with 60283-2-Ig (P53 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 60283-2-PBS in a different storage buffer formulation.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy× COLO 320 cells were subjected to SDS PAGE followed by western blot with 60283-2-Ig (P53 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 60283-2-PBS in a different storage buffer formulation.
WB analysis of HSC-T6 using 60283-2-Ig (same clone as 60283-2-PBS)
HSC-T6 cells were subjected to SDS PAGE followed by western blot with 60283-2-Ig (P53 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 60283-2-PBS in a different storage buffer formulation.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy× HSC-T6 cells were subjected to SDS PAGE followed by western blot with 60283-2-Ig (P53 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 60283-2-PBS in a different storage buffer formulation.
WB analysis of COLO 320 using 60283-2-Ig (same clone as 60283-2-PBS)
COLO 320 cells were subjected to SDS PAGE followed by western blot with 60283-2-Ig (P53 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 60283-2-PBS in a different storage buffer formulation.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy× COLO 320 cells were subjected to SDS PAGE followed by western blot with 60283-2-Ig (P53 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 60283-2-PBS in a different storage buffer formulation.
WB analysis of HSC-T6 using 60283-2-Ig (same clone as 60283-2-PBS)
HSC-T6 cells were subjected to SDS PAGE followed by western blot with 60283-2-Ig (P53 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 60283-2-PBS in a different storage buffer formulation.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy× HSC-T6 cells were subjected to SDS PAGE followed by western blot with 60283-2-Ig (P53 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 60283-2-PBS in a different storage buffer formulation.
WB analysis of ROS1728 using 60283-2-Ig (same clone as 60283-2-PBS)
ROS1728 cells were subjected to SDS PAGE followed by western blot with 60283-2-Ig (P53 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 60283-2-PBS in a different storage buffer formulation.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy× ROS1728 cells were subjected to SDS PAGE followed by western blot with 60283-2-Ig (P53 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 60283-2-PBS in a different storage buffer formulation.
WB analysis of COLO 320 using 60283-2-Ig (same clone as 60283-2-PBS)
COLO 320 cells were subjected to SDS PAGE followed by western blot with 60283-2-Ig (P53 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 60283-2-PBS in a different storage buffer formulation.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy× COLO 320 cells were subjected to SDS PAGE followed by western blot with 60283-2-Ig (P53 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 60283-2-PBS in a different storage buffer formulation.
WB analysis of HSC-T6 using 60283-2-Ig (same clone as 60283-2-PBS)
HSC-T6 cells were subjected to SDS PAGE followed by western blot with 60283-2-Ig (P53 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 60283-2-PBS in a different storage buffer formulation.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy× HSC-T6 cells were subjected to SDS PAGE followed by western blot with 60283-2-Ig (P53 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 60283-2-PBS in a different storage buffer formulation.
IHC staining of human lymphoma using 60283-2-Ig (same clone as 60283-2-PBS)
Immunohistochemical analysis of paraffin-embedded human lymphoma tissue slide using 60283-2-Ig (P53 antibody) at dilution of 1:8000. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). The staining was performed on an autostainer. This data was developed using the same antibody clone with 60283-2-PBS in a different storage buffer formulation.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy× Immunohistochemical analysis of paraffin-embedded human lymphoma tissue slide using 60283-2-Ig (P53 antibody) at dilution of 1:8000. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). The staining was performed on an autostainer. This data was developed using the same antibody clone with 60283-2-PBS in a different storage buffer formulation.
IHC staining of human ovary cancer using 60283-2-Ig (same clone as 60283-2-PBS)
Immunohistochemical analysis of paraffin-embedded human ovary cancer tissue slide using 60283-2-Ig (P53 antibody) at dilution of 1:8000. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). The staining was performed on an autostainer. This data was developed using the same antibody clone with 60283-2-PBS in a different storage buffer formulation.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy× Immunohistochemical analysis of paraffin-embedded human ovary cancer tissue slide using 60283-2-Ig (P53 antibody) at dilution of 1:8000. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). The staining was performed on an autostainer. This data was developed using the same antibody clone with 60283-2-PBS in a different storage buffer formulation.
IHC staining of human ovary cancer using 60283-2-Ig (same clone as 60283-2-PBS)
Immunohistochemical analysis of paraffin-embedded human ovary cancer tissue slide using 60283-2-Ig (P53 antibody) at dilution of 1:8000. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). The staining was performed on an autostainer. This data was developed using the same antibody clone with 60283-2-PBS in a different storage buffer formulation.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy× Immunohistochemical analysis of paraffin-embedded human ovary cancer tissue slide using 60283-2-Ig (P53 antibody) at dilution of 1:8000. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). The staining was performed on an autostainer. This data was developed using the same antibody clone with 60283-2-PBS in a different storage buffer formulation.
IHC staining of human ovary cancer using 60283-2-Ig (same clone as 60283-2-PBS)
Immunohistochemical analysis of paraffin-embedded human ovary cancer tissue slide using 60283-2-Ig (P53 antibody) at dilution of 1:8000. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). The staining was performed on an autostainer. This data was developed using the same antibody clone with 60283-2-PBS in a different storage buffer formulation.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy× Immunohistochemical analysis of paraffin-embedded human ovary cancer tissue slide using 60283-2-Ig (P53 antibody) at dilution of 1:8000. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). The staining was performed on an autostainer. This data was developed using the same antibody clone with 60283-2-PBS in a different storage buffer formulation.
IHC staining of human pancreas cancer using 60283-2-Ig (same clone as 60283-2-PBS)
Immunohistochemical analysis of paraffin-embedded human pancreas cancer tissue slide using 60283-2-Ig (P53 antibody) at dilution of 1:8000. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). The staining was performed on an autostainer. This data was developed using the same antibody clone with 60283-2-PBS in a different storage buffer formulation.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy× Immunohistochemical analysis of paraffin-embedded human pancreas cancer tissue slide using 60283-2-Ig (P53 antibody) at dilution of 1:8000. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). The staining was performed on an autostainer. This data was developed using the same antibody clone with 60283-2-PBS in a different storage buffer formulation.
IHC staining of human ovary cancer using 60283-2-Ig (same clone as 60283-2-PBS)
Immunohistochemical analysis of paraffin-embedded human ovary cancer tissue slide using 60283-2-Ig (P53 antibody) at dilution of 1:4000 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 60283-2-PBS in a different storage buffer formulation.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy× Immunohistochemical analysis of paraffin-embedded human ovary cancer tissue slide using 60283-2-Ig (P53 antibody) at dilution of 1:4000 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 60283-2-PBS in a different storage buffer formulation.
IHC staining of human ovary cancer using 60283-2-Ig (same clone as 60283-2-PBS)
Immunohistochemical analysis of paraffin-embedded human ovary cancer tissue slide using 60283-2-Ig (P53 antibody) at dilution of 1:4000 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 60283-2-PBS in a different storage buffer formulation.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy× Immunohistochemical analysis of paraffin-embedded human ovary cancer tissue slide using 60283-2-Ig (P53 antibody) at dilution of 1:4000 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 60283-2-PBS in a different storage buffer formulation.
IHC staining of human ovary tumor using 60283-2-Ig (same clone as 60283-2-PBS)
Immunohistochemical analysis of paraffin-embedded human ovary tumor tissue slide using 60283-2-Ig (P53 antibody) at dilution of 1:10000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 60283-2-PBS in a different storage buffer formulation.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy× Immunohistochemical analysis of paraffin-embedded human ovary tumor tissue slide using 60283-2-Ig (P53 antibody) at dilution of 1:10000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 60283-2-PBS in a different storage buffer formulation.
IHC staining of human colon cancer using 60283-2-Ig (same clone as 60283-2-PBS)
Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 60283-2-Ig (P53 antibody) at dilution of 1:10000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 60283-2-PBS in a different storage buffer formulation.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy× Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 60283-2-Ig (P53 antibody) at dilution of 1:10000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 60283-2-PBS in a different storage buffer formulation.
IHC staining of human colon cancer using 60283-2-Ig (same clone as 60283-2-PBS)
Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 60283-2-Ig (P53 antibody) at dilution of 1:10000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 60283-2-PBS in a different storage buffer formulation.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy× Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 60283-2-Ig (P53 antibody) at dilution of 1:10000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 60283-2-PBS in a different storage buffer formulation.
IHC staining of human skin cancer using 60283-2-Ig (same clone as 60283-2-PBS)
Immunohistochemical analysis of paraffin-embedded human skin cancer tissue slide using 60283-2-Ig (P53 antibody) at dilution of 1:10000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 60283-2-PBS in a different storage buffer formulation.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy× Immunohistochemical analysis of paraffin-embedded human skin cancer tissue slide using 60283-2-Ig (P53 antibody) at dilution of 1:10000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 60283-2-PBS in a different storage buffer formulation.
IHC staining of human colon cancer using 60283-2-Ig (same clone as 60283-2-PBS)
Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 60283-2-Ig (P53 antibody) at dilution of 1:3000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 60283-2-PBS in a different storage buffer formulation.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy× Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 60283-2-Ig (P53 antibody) at dilution of 1:3000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 60283-2-PBS in a different storage buffer formulation.
IHC staining of human colon cancer using 60283-2-Ig (same clone as 60283-2-PBS)
Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 60283-2-Ig (P53 antibody) at dilution of 1:3000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 60283-2-PBS in a different storage buffer formulation.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy× Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 60283-2-Ig (P53 antibody) at dilution of 1:3000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 60283-2-PBS in a different storage buffer formulation.
IHC staining of human ovary cancer using 60283-2-Ig (same clone as 60283-2-PBS)
Immunohistochemical analysis of paraffin-embedded human ovary cancer tissue slide using 60283-2-Ig (P53 antibody) at dilution of 1:8000. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 60283-2-PBS in a different storage buffer formulation.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy× Immunohistochemical analysis of paraffin-embedded human ovary cancer tissue slide using 60283-2-Ig (P53 antibody) at dilution of 1:8000. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 60283-2-PBS in a different storage buffer formulation.
IHC staining of human ovary cancer using 60283-2-Ig (same clone as 60283-2-PBS)
Immunohistochemical analysis of paraffin-embedded human ovary cancer tissue slide using 60283-2-Ig (P53 antibody) at dilution of 1:8000. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 60283-2-PBS in a different storage buffer formulation.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy× Immunohistochemical analysis of paraffin-embedded human ovary cancer tissue slide using 60283-2-Ig (P53 antibody) at dilution of 1:8000. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 60283-2-PBS in a different storage buffer formulation.
IHC staining of human pancreas cancer using 60283-2-Ig (same clone as 60283-2-PBS)
Immunohistochemical analysis of paraffin-embedded human pancreas cancer tissue slide using 60283-2-Ig (P53 antibody) at dilution of 1:8000. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 60283-2-PBS in a different storage buffer formulation.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy× Immunohistochemical analysis of paraffin-embedded human pancreas cancer tissue slide using 60283-2-Ig (P53 antibody) at dilution of 1:8000. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 60283-2-PBS in a different storage buffer formulation.
IHC staining of human ovary cancer using 60283-2-Ig (same clone as 60283-2-PBS)
Immunohistochemical analysis of paraffin-embedded human ovary cancer tissue slide using 60283-2-Ig (P53 antibody) at dilution of 1:8000. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 60283-2-PBS in a different storage buffer formulation.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy× Immunohistochemical analysis of paraffin-embedded human ovary cancer tissue slide using 60283-2-Ig (P53 antibody) at dilution of 1:8000. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 60283-2-PBS in a different storage buffer formulation.
IHC staining of human colon cancer using 60283-2-Ig (same clone as 60283-2-PBS)
Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 60283-2-Ig (P53 antibody) at dilution of 1:400 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 60283-2-PBS in a different storage buffer formulation.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy× Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 60283-2-Ig (P53 antibody) at dilution of 1:400 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 60283-2-PBS in a different storage buffer formulation.
IHC staining of human colon cancer using 60283-2-Ig (same clone as 60283-2-PBS)
Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 60283-2-Ig (P53 antibody) at dilution of 1:400 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 60283-2-PBS in a different storage buffer formulation.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy× Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 60283-2-Ig (P53 antibody) at dilution of 1:400 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 60283-2-PBS in a different storage buffer formulation.
IHC staining of human gliomas using 60283-2-Ig (same clone as 60283-2-PBS)
Immunohistochemical analysis of paraffin-embedded human gliomas tissue slide using 60283-2-Ig (P53 antibody) at dilution of 1:400 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 60283-2-PBS in a different storage buffer formulation.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy× Immunohistochemical analysis of paraffin-embedded human gliomas tissue slide using 60283-2-Ig (P53 antibody) at dilution of 1:400 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 60283-2-PBS in a different storage buffer formulation.
IHC staining of human gliomas using 60283-2-Ig (same clone as 60283-2-PBS)
Immunohistochemical analysis of paraffin-embedded human gliomas tissue slide using 60283-2-Ig (P53 antibody) at dilution of 1:400 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 60283-2-PBS in a different storage buffer formulation.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy× Immunohistochemical analysis of paraffin-embedded human gliomas tissue slide using 60283-2-Ig (P53 antibody) at dilution of 1:400 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 60283-2-PBS in a different storage buffer formulation.
IHC staining of human colon cancer using 60283-2-Ig (same clone as 60283-2-PBS)
Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 60283-2-Ig (P53 antibody) at dilution of 1:400 (under 10x lens) Heat mediated antigen retrieved with Sodium Citrate buffer (pH 6.0). This data was developed using the same antibody clone with 60283-2-PBS in a different storage buffer formulation.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy× Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 60283-2-Ig (P53 antibody) at dilution of 1:400 (under 10x lens) Heat mediated antigen retrieved with Sodium Citrate buffer (pH 6.0). This data was developed using the same antibody clone with 60283-2-PBS in a different storage buffer formulation.
IHC staining of human colon cancer using 60283-2-Ig (same clone as 60283-2-PBS)
Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 60283-2-Ig (P53 antibody) at dilution of 1:400 (under 40x lens) Heat mediated antigen retrieved with Sodium Citrate buffer (pH 6.0). This data was developed using the same antibody clone with 60283-2-PBS in a different storage buffer formulation.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy× Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 60283-2-Ig (P53 antibody) at dilution of 1:400 (under 40x lens) Heat mediated antigen retrieved with Sodium Citrate buffer (pH 6.0). This data was developed using the same antibody clone with 60283-2-PBS in a different storage buffer formulation.
IHC staining of human colon cancer using 60283-2-Ig (same clone as 60283-2-PBS)
Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 60283-2-Ig (P53 antibody) at dilution of 1:300 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 60283-2-PBS in a different storage buffer formulation.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy× Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 60283-2-Ig (P53 antibody) at dilution of 1:300 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 60283-2-PBS in a different storage buffer formulation.
IHC staining of human colon cancer using 60283-2-Ig (same clone as 60283-2-PBS)
Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 60283-2-Ig (P53 antibody) at dilution of 1:300 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 60283-2-PBS in a different storage buffer formulation.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy× Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 60283-2-Ig (P53 antibody) at dilution of 1:300 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 60283-2-PBS in a different storage buffer formulation.
IHC staining of human lung cancer using 60283-2-Ig (same clone as 60283-2-PBS)
Immunohistochemical analysis of paraffin-embedded human lung cancer tissue slide using 60283-2-Ig (P53 antibody) at dilution of 1:300 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 60283-2-PBS in a different storage buffer formulation.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy× Immunohistochemical analysis of paraffin-embedded human lung cancer tissue slide using 60283-2-Ig (P53 antibody) at dilution of 1:300 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 60283-2-PBS in a different storage buffer formulation.
IHC staining of human lung cancer using 60283-2-Ig (same clone as 60283-2-PBS)
Immunohistochemical analysis of paraffin-embedded human lung cancer tissue slide using 60283-2-Ig (P53 antibody) at dilution of 1:300 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 60283-2-PBS in a different storage buffer formulation.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy× Immunohistochemical analysis of paraffin-embedded human lung cancer tissue slide using 60283-2-Ig (P53 antibody) at dilution of 1:300 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 60283-2-PBS in a different storage buffer formulation.
IHC staining of human breast cancer using 60283-2-Ig (same clone as 60283-2-PBS)
Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 60283-2-Ig (P53 antibody) at dilution of 1:300 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 60283-2-PBS in a different storage buffer formulation.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy× Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 60283-2-Ig (P53 antibody) at dilution of 1:300 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 60283-2-PBS in a different storage buffer formulation.
IHC staining of human breast cancer using 60283-2-Ig (same clone as 60283-2-PBS)
Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 60283-2-Ig (P53 antibody) at dilution of 1:300 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 60283-2-PBS in a different storage buffer formulation.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy× Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 60283-2-Ig (P53 antibody) at dilution of 1:300 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 60283-2-PBS in a different storage buffer formulation.
IHC staining of human stomach cancer using 60283-2-Ig (same clone as 60283-2-PBS)
Immunohistochemical analysis of paraffin-embedded human stomach cancer tissue slide using 60283-2-Ig (P53 antibody) at dilution of 1:300 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 60283-2-PBS in a different storage buffer formulation.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy× Immunohistochemical analysis of paraffin-embedded human stomach cancer tissue slide using 60283-2-Ig (P53 antibody) at dilution of 1:300 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 60283-2-PBS in a different storage buffer formulation.
IHC staining of human stomach cancer using 60283-2-Ig (same clone as 60283-2-PBS)
Immunohistochemical analysis of paraffin-embedded human stomach cancer tissue slide using 60283-2-Ig (P53 antibody) at dilution of 1:300 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 60283-2-PBS in a different storage buffer formulation.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy× Immunohistochemical analysis of paraffin-embedded human stomach cancer tissue slide using 60283-2-Ig (P53 antibody) at dilution of 1:300 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 60283-2-PBS in a different storage buffer formulation.
IHC staining of human tonsillitis using 60283-2-Ig (same clone as 60283-2-PBS)
Immunohistochemical analysis of paraffin-embedded human tonsillitis tissue slide using 60283-2-Ig (P53 antibody) at dilution of 1:3200 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 60283-2-PBS in a different storage buffer formulation.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy× Immunohistochemical analysis of paraffin-embedded human tonsillitis tissue slide using 60283-2-Ig (P53 antibody) at dilution of 1:3200 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 60283-2-PBS in a different storage buffer formulation.
IHC staining of human tonsillitis using 60283-2-Ig (same clone as 60283-2-PBS)
Immunohistochemical analysis of paraffin-embedded human tonsillitis tissue slide using 60283-2-Ig (P53 antibody) at dilution of 1:3200 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 60283-2-PBS in a different storage buffer formulation.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy× Immunohistochemical analysis of paraffin-embedded human tonsillitis tissue slide using 60283-2-Ig (P53 antibody) at dilution of 1:3200 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 60283-2-PBS in a different storage buffer formulation.
IHC staining of human ovary tumor using 60283-2-Ig (same clone as 60283-2-PBS)
Immunohistochemical analysis of paraffin-embedded human ovary tumor tissue slide using 60283-2-Ig (P53 antibody) at dilution of 1:3200 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 60283-2-PBS in a different storage buffer formulation.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy× Immunohistochemical analysis of paraffin-embedded human ovary tumor tissue slide using 60283-2-Ig (P53 antibody) at dilution of 1:3200 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 60283-2-PBS in a different storage buffer formulation.
IHC staining of human ovary tumor using 60283-2-Ig (same clone as 60283-2-PBS)
Immunohistochemical analysis of paraffin-embedded human ovary tumor tissue slide using 60283-2-Ig (P53 antibody) at dilution of 1:3200 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 60283-2-PBS in a different storage buffer formulation.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy× Immunohistochemical analysis of paraffin-embedded human ovary tumor tissue slide using 60283-2-Ig (P53 antibody) at dilution of 1:3200 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 60283-2-PBS in a different storage buffer formulation.
IHC staining of human colon cancer using 60283-2-Ig (same clone as 60283-2-PBS)
Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 60283-2-Ig (P53 antibody) at dilution of 1:1600 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 60283-2-PBS in a different storage buffer formulation.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy× Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 60283-2-Ig (P53 antibody) at dilution of 1:1600 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 60283-2-PBS in a different storage buffer formulation.
IHC staining of human colon cancer using 60283-2-Ig (same clone as 60283-2-PBS)
Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 60283-2-Ig (P53 antibody) at dilution of 1:1600 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 60283-2-PBS in a different storage buffer formulation.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy× Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 60283-2-Ig (P53 antibody) at dilution of 1:1600 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 60283-2-PBS in a different storage buffer formulation.
IF Staining of A431 using 60283-2-Ig (same clone as 60283-2-PBS)
Immunofluorescent analysis of (4% PFA) fixed A431 cells using P53 antibody (60283-2-Ig, Clone: 6C4B6 ) at dilution of 1:800 and CoraLite®488-Conjugated Goat Anti-Mouse IgG(H+L) (SA00013-1), CL594-phalloidin (red). This data was developed using the same antibody clone with 60283-2-PBS in a different storage buffer formulation.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy× Immunofluorescent analysis of (4% PFA) fixed A431 cells using P53 antibody (60283-2-Ig, Clone: 6C4B6 ) at dilution of 1:800 and CoraLite®488-Conjugated Goat Anti-Mouse IgG(H+L) (SA00013-1), CL594-phalloidin (red). This data was developed using the same antibody clone with 60283-2-PBS in a different storage buffer formulation.
Cytometric bead array in cell lysate using MP50182-1
Cytometric bead array in cell lysate using MP50182-1, Phospho-P53 (Ser15) Monoclonal Matched Antibody Pair, PBS Only. Capture antibody: 67826-1-PBS. Detection antibody: 60283-2-PBS. Cell lysate: Non-treated HT-29 and Calyculin A treated HT-29 (30μg/well). Non-related target CEACAM1 Monoclonal Matched Antibody Pair (MP50132-1) was served as control.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy× Cytometric bead array in cell lysate using MP50182-1, Phospho-P53 (Ser15) Monoclonal Matched Antibody Pair, PBS Only. Capture antibody: 67826-1-PBS. Detection antibody: 60283-2-PBS. Cell lysate: Non-treated HT-29 and Calyculin A treated HT-29 (30μg/well). Non-related target CEACAM1 Monoclonal Matched Antibody Pair (MP50132-1) was served as control.
Cytometric bead array in cell lysate using MP50184-1
Cytometric bead array in cell lysate using MP50184-1, Phospho-P53 (Ser46) Monoclonal Matched Antibody Pair, PBS Only. Capture antibody: 60283-2-PBS. Detection antibody: 67900-1-PBS. Cell lysate: Non-treated HT-29 and Calyculin A treated HT-29 (30μg/well). Non-related target CEACAM1 Monoclonal Matched Antibody Pair (MP50132-1) was served as control.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy× Cytometric bead array in cell lysate using MP50184-1, Phospho-P53 (Ser46) Monoclonal Matched Antibody Pair, PBS Only. Capture antibody: 60283-2-PBS. Detection antibody: 67900-1-PBS. Cell lysate: Non-treated HT-29 and Calyculin A treated HT-29 (30μg/well). Non-related target CEACAM1 Monoclonal Matched Antibody Pair (MP50132-1) was served as control.
ChIP experiment of HCT 116 using 60283-2-Ig (same clone as 60283-2-PBS)
Chromatin was prepared from HCT 116 cells treated with Etoposide (50 µM, 6 h). Cells were fixed with formaldehyde for 10 minutes. The ChIP was performed with 15 µg of cross-linked chromatin, 5 µg of P53 (60283-2-Ig) or 5 ug of Normal Mouse IgG2b (66360-3-Ig), and 20 µl of Protein A Magarose Beads. The immunoprecipitated DNA was quantified by real-time PCR. This data was developed using the same antibody clone with 60283-2-PBS in a different storage buffer formulation.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy× Chromatin was prepared from HCT 116 cells treated with Etoposide (50 µM, 6 h). Cells were fixed with formaldehyde for 10 minutes. The ChIP was performed with 15 µg of cross-linked chromatin, 5 µg of P53 (60283-2-Ig) or 5 ug of Normal Mouse IgG2b (66360-3-Ig), and 20 µl of Protein A Magarose Beads. The immunoprecipitated DNA was quantified by real-time PCR. This data was developed using the same antibody clone with 60283-2-PBS in a different storage buffer formulation.
Product Information
60283-2-PBS targets P53 as part of a matched antibody pair:
MP50182-1: 67826-1-PBS capture and 60283-2-PBS detection (validated in Cytometric bead array)
MP50184-1: 60283-2-PBS capture and 67900-1-PBS detection (validated in Cytometric bead array)
Unconjugated mouse monoclonal antibody pair in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation.
This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.
| Tested Reactivity | human, rat |
| Host / Isotype | Mouse / IgG2b |
| Class | Monoclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag0698 Product name: Recombinant human P53 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-232 aa of BC003596 Sequence: MEEPQSDPSVEPPLSQETFSDLWKLLPENNVLSPLPSQAMDDLMLSPDDIEQWFTEDPGPDEAPRMPEAAPRVAPAPAAPTPAAPAPAPSWPLSSSVPSQKTYQGSYGFRLGFLHSGTAKSVTCTYSPALNKMFCQLAKTCPVQLWVDSTPPPGTRVRAMAIYKQSQHMTEVVRRCPHHERCSDSDGLAPPQHLIRVEGNLRVEYLDDRNTFRHSVVVPYEPPEVGSDCTTI Predict reactive species |
| Full Name | tumor protein p53 |
| Calculated Molecular Weight | 44 kDa |
| Observed Molecular Weight | 53 kDa |
| GenBank Accession Number | BC003596 |
| Gene Symbol | P53 |
| Gene ID (NCBI) | 7157 |
| RRID | AB_2881401 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein A purification |
| UNIPROT ID | P04637 |
| Storage Buffer | PBS only, pH 7.3. |
| Storage Conditions | Store at -80°C. |
Background Information
1. What is p53?
P53 is a tumor suppressor gene that plays a role in maintaining genomic stability and controlling apoptosis. During the cell cycle, it can arrest cells at the G1/S checkpoint and activate DNA repair mechanisms. It is the most mutated gene in cancer. In unstressed cells, p53 usually exists at low levels in an inactive form, being bound to Mdm2.
2. FAQs and p53
a. I fail to detect p53 by western blotting
Basal levels of wild-type p53 in untreated cells can be low. Try to load more cell lysate and use a positive control - a lysate of cells treated with DNA-damaging agents should increase p53 levels.
b. I fail to detect p53 in some cell lines by western blotting
Various p53 mutations are present in cancer cell types. If mutations cause truncations/deletions some monoclonal antibodies may no longer recognize mutated p53. You have more chances of detecting various p53 mutants with our polyclonal antibody.
c. I can detect more than one band ~50 kDa size / different cell lines give bands at slightly different size
p53 is a subject of post-translational modifications (http://p53.free.fr/p53_info/p53_modifications.html) and more than one isoform may be expressed (http://p53.free.fr/p53_info/p53_isoforms.html). Also, it is possible that your cell line of interest expresses one allele with mutated p53 with altered molecular weight.
