• Featured Product
  • KD/KO Validated

P53 Monoclonal antibody

P53 Monoclonal Antibody for WB, IHC, IF/ICC, ELISA
Cat No. 60283-2-Ig
Clone No.6C4B6

Host / Isotype

Mouse / IgG2b

Reactivity

human, rat and More (5)

Applications

WB, IHC, IF/ICC, IP, CoIP, ELISA

TP53, 6C4B6, Antigen NY-CO-13, tumor protein p53, Tumor suppressor p53

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inA431 cells, COLO 320 cells, HSC-T6 cells, rat thymus tissue, ROS1728 cells, HaCaT cells, HT-29 cells, HEK-293 cells
Positive IHC detected inhuman ovary cancer tissue, human breast cancer tissue, human colon cancer tissue, human gliomas tissue, human lung cancer tissue, human ovary tumor tissue, human stomach cancer tissue, human tonsillitis tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF/ICC detected inA431 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:5000-1:50000
Immunohistochemistry (IHC)IHC : 1:2000-1:8000
Immunofluorescence (IF)/ICCIF/ICC : 1:400-1:1600
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

60283-2-Ig targets P53 in WB, IHC, IF/ICC, IP, CoIP, ELISA applications and shows reactivity with human, rat samples.

Tested Reactivity human, rat
Cited Reactivityhuman, rat, pig, rabbit, canine, zebrafish, hamster
Host / Isotype Mouse / IgG2b
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag0698

Product name: Recombinant human P53 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-232 aa of BC003596

Sequence: MEEPQSDPSVEPPLSQETFSDLWKLLPENNVLSPLPSQAMDDLMLSPDDIEQWFTEDPGPDEAPRMPEAAPRVAPAPAAPTPAAPAPAPSWPLSSSVPSQKTYQGSYGFRLGFLHSGTAKSVTCTYSPALNKMFCQLAKTCPVQLWVDSTPPPGTRVRAMAIYKQSQHMTEVVRRCPHHERCSDSDGLAPPQHLIRVEGNLRVEYLDDRNTFRHSVVVPYEPPEVGSDCTTI

Predict reactive species
Full Name tumor protein p53
Calculated Molecular Weight 44 kDa
Observed Molecular Weight 53 kDa
GenBank Accession NumberBC003596
Gene Symbol P53
Gene ID (NCBI) 7157
RRIDAB_2881401
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP04637
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

1.       What is p53?

P53 is a tumor suppressor gene that plays a role in maintaining genomic stability and controlling apoptosis. During the cell cycle, it can arrest cells at the G1/S checkpoint and activate DNA repair mechanisms. It is the most mutated gene in cancer. In unstressed cells, p53 usually exists at low levels in an inactive form, being bound to Mdm2.

2.       FAQs and p53

a.       I fail to detect p53 by western blotting

Basal levels of wild-type p53 in untreated cells can be low. Try to load more cell lysate and use a positive control - a lysate of cells treated with DNA-damaging agents should increase p53 levels.

b.      I fail to detect p53 in some cell lines by western blotting

Various p53 mutations are present in cancer cell types. If mutations cause truncations/deletions some monoclonal antibodies may no longer recognize mutated p53. You have more chances of detecting various p53 mutants with our polyclonal antibody.

c.       I can detect more than one band ~50 kDa size / different cell lines give bands at slightly different size

p53 is a subject of post-translational modifications (http://p53.free.fr/p53_info/p53_modifications.html) and more than one isoform may be expressed (http://p53.free.fr/p53_info/p53_isoforms.html). Also, it is possible that your cell line of interest expresses one allele with mutated p53 with altered molecular weight.


Protocols

Product Specific Protocols
IF protocol for P53 antibody 60283-2-IgDownload protocol
IHC protocol for P53 antibody 60283-2-IgDownload protocol
WB protocol for P53 antibody 60283-2-IgDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
WB

Bioact Mater

Chemo-immunotherapy by dual-enzyme responsive peptide self-assembling abolish melanoma

Authors - Yuhan Wang
WB

Nat Commun

Circular RNA encoded MET variant promotes glioblastoma tumorigenesis

Authors - Jian Zhong
WB

Redox Biol

Deficiency of S100 calcium binding protein A9 attenuates vascular dysfunction in aged mice

Authors - Boying Zhao
IHC

Aging (Albany NY)

Whole-transcriptome sequencing analysis reveal mechanisms of Yiqi Huoxue Yangyin (YHY) decoction in ameliorating D-gal-induced cardiac aging

Authors - Xue Wang
WB

J Adv Res

TRPM2-mediated feed-forward loop promotes chondrocyte damage in osteoarthritis via calcium-cGAS-STING-NF-κB pathway

Authors - Kai Sun
humanWB

Clin Transl Med

p53 inhibits OTUD5 transcription to promote GPX4 degradation and induce ferroptosis in gastric cancer

Authors - Junjing Zhang

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


FH

Prakash (Verified Customer) (10-28-2025)

working good in western.

  • Applications: Western Blot
  • Cell Tissue Type: Bladder tissue
FH

Chiara (Verified Customer) (03-10-2023)

The antibody work well and was specific on the target

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:5000
  • Cell Tissue Type: DPSC
P53 Antibody Western Blot validation (1:5000 dilution) in DPSC (Cat no:60283-2-Ig)
FH

Janelle (Verified Customer) (09-12-2022)

Specific to target

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:1000
FH

Allison (Verified Customer) (08-19-2019)

The antibody specifications online were easy to follow. I used the recommended dilution of antibody of 1:2000 which worked and could probably be diluted further.

  • Applications: Western Blot,
  • Primary Antibody Dilution: milk
  • Cell Tissue Type: MCF7 breast cancer cells
Loading...
||
New chat

Able

正在加载,请稍候...