CoraLite®594-conjugated Osteocalcin/OCN Polyclonal antibody

• 

  IF Staining of NIH/3T3 using CL594-23418

  Immunofluorescent analysis of (-20°C Ethanol) fixed NIH/3T3 cells using CoraLite®594 Osteocalcin antibody (CL594-23418) at dilution of 1:400.

• 

  FC experiment of NIH/3T3 using CL594-23418

  1X10^6 NIH/3T3 cells were intracellularly stained with 0.5 ug CoraLite®594 Anti-Human Osteocalcin (CL594-23418) (red), or 0.5 ug CoraLite®594-conjugated Rabbit IgG control Rabbit PolyAb (CL594-30000, Clone: ) (blue). Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer.

Osteocalcin/OCN Polyclonal Antibody for IF/ICC, FC (Intra)

Cat No. CL594-23418

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

IF/ICC, FC (Intra)

Synonyms

BGLAP, Osteocalcin, BGP, Bone Gla protein, Gamma-carboxyglutamic acid-containing protein

---

Tested Applications

• Positive IF/ICC detected in: NIH/3T3 cells
• Positive FC (Intra) detected in: NIH/3T3 cells

Recommended dilution

• Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800
• Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.50 ug per 10^6 cells in a 100 µl suspension

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

CL594-23418 targets Osteocalcin/OCN in IF/ICC, FC (Intra) applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag20065

  Product name: Recombinant human Osteocalcin protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 24-100 aa of BC113432

  Sequence: KPSGAESSKGAAFVSKQEGSEVVKRPRRYLYQWLGAPVPYPDPLEPRREVCELNPDCDELADHIGFQEAYRRFYGPV

• Full Name: bone gamma-carboxyglutamate (gla) protein
• Calculated Molecular Weight: 100 aa, 11 kDa
• GenBank Accession Number: BC113432
• Gene Symbol: Osteocalcin
• Gene ID (NCBI): 632
• RRID: AB_2919870
• Conjugate: CoraLite®594 Fluorescent Dye
• Excitation/Emission Maxima Wavelengths: 588 nm / 604 nm
• Excitation Laser: Yellow-Green Laser (561 nm)
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P02818
• Storage Buffer: PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
• Storage Conditions: Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage.

Background Information

Osteocalcin is a small, highly conserved molecule associated with mineralization of bone matrix. Osteocalcin is specifically expressed in osteoblasts and is the most abundant non-collagenous protein in bone. It regulates the dynamics of new bone formation and bone resorption by interaction with vitamin D, and by influencing the differentiation of osteoblasts. Osteocalcin is also involved in the posttranslational targeting of vitamin K-dependent gamma-carboxylation, which controls blood coagulation.