Tested Applications
| Positive IF-P detected in | mouse brain tissue |
Recommended dilution
| Application | Dilution |
|---|---|
| Immunofluorescence (IF)-P | IF-P : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
CL488-84401-4 targets NeuN in IF-P applications and shows reactivity with human, mouse, rat, pig samples.
| Tested Reactivity | human, mouse, rat, pig |
| Host / Isotype | Rabbit / IgG |
| Class | Recombinant |
| Type | Antibody |
| Immunogen |
CatNo: Ag25689 Product name: Recombinant human NeuN protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-100 aa of NM_001082575 Sequence: MAQPYPPAQYPPPPQNGIPAEYAPPPPHPTQDYSGQTPVPTEHGMTLYTPAQTHPEQPGSEASTQPIAGTQTVPQTDEAAQTDSQPLHPSDPTEKQQPKR Predict reactive species |
| Full Name | hexaribonucleotide binding protein 3 |
| Observed Molecular Weight | 46-52 kDa |
| GenBank Accession Number | NM_001082575 |
| Gene Symbol | NeuN |
| Gene ID (NCBI) | 146713 |
| Conjugate | CoraLite® Plus 488 Fluorescent Dye |
| Excitation/Emission Maxima Wavelengths | 493 nm / 522 nm |
| Form | Liquid |
| Purification Method | Protein A purification |
| UNIPROT ID | A6NFN3 |
| Storage Buffer | PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3. |
| Storage Conditions | Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. |
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for CL Plus 488 NeuN antibody CL488-84401-4 | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |

