MYB/c-Myb Monoclonal antibody

MYB/c-Myb Monoclonal Antibody for WB, FC (Intra), ELISA
Cat No. 68542-1-Ig
Clone No.2C4A5

Host / Isotype

Mouse / IgG1

Reactivity

human

Applications

WB, FC (Intra), ELISA

MYB, c-Myb, Transcriptional activator Myb, Proto-oncogene c-Myb, Proto oncogene c Myb

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inJurkat cells, MOLT-4 cells
Positive FC (Intra) detected inJurkat cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:2000-1:10000
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

68542-1-Ig targets MYB/c-Myb in WB, FC (Intra), ELISA applications and shows reactivity with human samples.

Tested Reactivity human
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag12021

Product name: Recombinant human MYB protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 1-356 aa of BC064955

Sequence: MARRPRHSIYSSDEDDEDFEMCDHDYDGLLPKSGKRHLGKTRWTREEDEKLKKLVEQNGTDDWKVIANYLPNRTDVQCQHRWQKVLNPELIKGPWTKEEDQRVIELVQKYGPKRWSVIAKHLKGRIGKQCRERWHNHLNPEVKKTSWTEEEDRIIYQAHKRLGNRWAEIAKLLPGRTDNAIKNHWNSTMRRKVEQEGYLQESSKASQPAVATSFQKNSHLMGFAQAPPTAQLPATGQPTVNNDYSYYHISEAQNVSSHVPYPVALHVNIVNVPQPAAAAIQRHYNDEDPEKEKRIKELELLLMSTENELKGQQVLPTQNHTCSYPGWHSTTIADHTRPHGDSAPVSCLGEHHSTPS

Predict reactive species
Full Name v-myb myeloblastosis viral oncogene homolog (avian)
Calculated Molecular Weight 640 aa, 72 kDa
Observed Molecular Weight40-50 kDa, 72-80 kDa
GenBank Accession NumberBC064955
Gene Symbol c-Myb
Gene ID (NCBI) 4602
RRIDAB_3085249
Conjugate Unconjugated
FormLiquid
Purification MethodProtein G purification
UNIPROT IDP10242
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

The MYB protein is a transcription factor that plays a key role in regulating the proliferation/differentiation of progenitor cells in bone marrow, colonic crypts, and neurogenic niches [PMID:18574464]. It is involved in the regulation of epithelial-to-mesenchymal transition (EMT) and invasion in neuroblastoma, colon carcinoma, and embryonic kidney cells through the upregulation of the transcription repressor Slug [PMID:20622260]. It also a DNA-binding protein that specifically recognize the sequence 5'-YAAC[GT]G-3', and plays an important role in the control of proliferation and differentiation of hematopoietic progenitor cells. MYB exists some isoforms with MV 85, 75, 72, 68, 63 and 40 kDa.

Protocols

Product Specific Protocols
WB protocol for MYB/c-Myb antibody 68542-1-IgDownload protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...