MSH2 Monoclonal antibody, PBS Only (Capture)

• 

  WB analysis of HeLa using 60161-1-Ig (same clone as 60161-1-PBS)

  WB results of MSH2 (60161-1-Ig, 1:1000) antibody with si-Control and si-MSH2 transfected HeLa cells.. This data was developed using the same antibody clone with 60161-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 60161-1-Ig (same clone as 60161-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 60161-1-Ig (MSH2 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 60161-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 60161-1-Ig (same clone as 60161-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 60161-1-Ig (MSH2 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 60161-1-PBS in a different storage buffer formulation.

• 

  Sandwich ELISA standard curve of MP50235-1

  Sandwich ELISA standard curve of MP50235-1, Human MSH2 Monoclonal Matched Antibody Pair - PBS only. 60161-1-PBS was coated to a plate as the capture antibody and incubated with serial dilutions of standard Ag7835. 60161-2-PBS was HRP conjugated as the detection antibody. Range: 0.781-50 ng/mL

• 

  Sample test of MP50235-1

  The mean MSH2 concentration was determined to be 10.60 ng/mL in A375 cell extract based on a 2.0 mg/mL extract load and 17.80 ng/mL in A549 cell extract based on a 2.6 mg/mL extract load.

• 

  IHC staining of human colon cancer using 60161-1-Ig (same clone as 60161-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 60161-1-Ig (MSH2 Antibody) at dilution of 1:800 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 60161-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human colon cancer using 60161-1-Ig (same clone as 60161-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 60161-1-Ig (MSH2 Antibody) at dilution of 1:800 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 60161-1-PBS in a different storage buffer formulation.

• 

  IHC staining of Ramos using 60161-1-Ig (same clone as 60161-1-PBS)

  Immunohistochemical analysis of paraffin-embedded Ramos cells slide using 60161-1-Ig (MSH2 antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 60161-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human colon cancer using 60161-1-Ig (same clone as 60161-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 60161-1-Ig (MSH2 Antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 60161-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human colon cancer using 60161-1-Ig (same clone as 60161-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 60161-1-Ig (MSH2 Antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 60161-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human colon cancer using 60161-1-Ig (same clone as 60161-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 60161-1-Ig (MSH2 Antibody) at dilution of 1:400 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 60161-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human colon cancer using 60161-1-Ig (same clone as 60161-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 60161-1-Ig (MSH2 Antibody) at dilution of 1:400 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 60161-1-PBS in a different storage buffer formulation.

• 

  IF Staining of A431 using 60161-1-Ig (same clone as 60161-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed A431 cells using MSH2 antibody (60161-1-Ig, Clone: 2H5F5 ) at dilution of 1:2277 and Multi-rAb CoraLite® Plus 647-Goat Anti-Mouse Recombinant Secondary Antibody (H+L) (Cat.NO. RGAM005). This data was developed using the same antibody clone with 60161-1-PBS in a different storage buffer formulation.

• 

  IF Staining of A431 using 60161-1-Ig (same clone as 60161-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed A431 cells using MSH2 antibody (60161-1-Ig, Clone: 2H5F5 ) at dilution of 1:1000 and Multi-rAb CoraLite® Plus 647-Goat Anti-Mouse Recombinant Secondary Antibody (H+L) (Cat.NO. RGAM005). This data was developed using the same antibody clone with 60161-1-PBS in a different storage buffer formulation.

• 

  Cytometric bead array standard curve of MP50235-1

  Cytometric bead array standard curve of MP50235-1, MSH2 Monoclonal Matched Antibody Pair, PBS Only. Capture antibody: 60161-1-PBS. Detection antibody: 60161-2-PBS. Standard:Ag7835. Range: 0.781-100 ng/mL.

• Featured Product
• KD/KO Validated

MSH2 Monoclonal Antibody for WB, IHC, IF/ICC, Cytometric bead array, Sandwich ELISA, Indirect ELISA, Sample test

Cat No. 60161-1-PBS

Clone No.2H5F5

Host / Isotype

Mouse / IgG1

Reactivity

human

Applications

WB, IHC, IF/ICC, Cytometric bead array, Sandwich ELISA, Indirect ELISA, Sample test

Synonyms

2H5F5, MSH 2

---

Product Information

60161-1-PBS targets MSH2 as part of a matched antibody pair:

MP50235-1: 60161-1-PBS capture and 60161-2-PBS detection (validated in Cytometric bead array, Sandwich ELISA)

Unconjugated mouse monoclonal antibody pair in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

• Tested Reactivity: human
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag7835

  Product name: Recombinant human MSH2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 585-934 aa of BC021566

  Sequence: SSGYVEPMQTLNDVLAQLDAVVSFAHVSNGAPVPYVRPAILEKGQGRIILKASRHACVEVQDEIAFIPNDVYFEKDKQMFHIITGPNMGGKSTYIRQTGVIVLMAQIGCFVPCESAEVSIVDCILARVGAGDSQLKGVSTFMAEMLETASILRSATKDSLIIIDELGRGTSTYDGFGLAWAISEYIATKIGAFCMFATHFHELTALANQIPTVNNLHVTALTTEETLTMLYQVKKGVCDQSFGIHVAELANFPKHVIECAKQKALELEEFQYIGESQGYDIMEPAAKKCYLEREQGEKIIQEFLSKVKQMPFTEMSEENITIKLKQLKAEVIAKNNSFVNEIISRIKVTT

• Full Name: mutS homolog 2, colon cancer, nonpolyposis type 1 (E. coli)
• Calculated Molecular Weight: 105 kDa
• Observed Molecular Weight: 105 kDa
• GenBank Accession Number: BC021566
• Gene Symbol: MSH2
• Gene ID (NCBI): 4436
• RRID: AB_10666855
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: P43246
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

MSH2, named for its homologous to the E.coli MutS gene, takes part in DNA mismatch repair(MMR) to maintain the stability of DNA. MSH2 contains a helix-turn-helix domain, which responds for binding to DNA. Also, MSH2 has a direct role in mutation avoidance and micro-satellite stability in cell.