• Featured Product
  • KD/KO Validated

CoraLite®594-conjugated MMP-9 (N-terminal) Polyclonal antibody

MMP-9 (N-terminal) Polyclonal Antibody for IF/ICC, FC (Intra)
Cat No. CL594-10375

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

IF/ICC, FC (Intra)

MMP9 (N-terminal), MMP9, 67 kDa matrix metalloproteinase-9, 82 kDa matrix metalloproteinase-9, CLG4B

Formulation:  PBS, Proclin 300, BSA, Glycerol
PBS, Proclin 300, BSA, Glycerol
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IF/ICC detected inHepG2 cells
Positive FC (Intra) detected inHeLa cells

Recommended dilution

ApplicationDilution
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Published Applications

IFSee 1 publications below

Product Information

CL594-10375 targets MMP-9 (N-terminal) in IF/ICC, FC (Intra) applications and shows reactivity with human samples.

Tested Reactivity human
Cited Reactivityhuman
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag0552

Product name: Recombinant human MMP9 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-100 aa of BC006093

Sequence: MSLWQPLVLVLLVLGCCFAAPRQRQSTLVLFPGDLRTNLTDRQLAEEYLYRYGYTRVAEMRGESKSLGPALLLLQKQLSLPETGELDSATLKAMRTPRCG

Predict reactive species
Full Name matrix metallopeptidase 9 (gelatinase B, 92kDa gelatinase, 92kDa type IV collagenase)
Calculated Molecular Weight 707 aa, 78 kDa
Observed Molecular Weight 67 kDa, 92 kDa
GenBank Accession NumberBC006093
Gene Symbol MMP-9
Gene ID (NCBI) 4318
RRIDAB_2919732
Conjugate CoraLite®594 Fluorescent Dye
Excitation/Emission Maxima Wavelengths588 nm / 604 nm
Excitation LaserYellow-Green Laser (561 nm)
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDP14780
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

Proteins of the matrix metalloproteinase (MMP) family are involved in the breakdown of extracellular matrix in normal physiological processes, such as embryonic development, reproduction, tissue remodeling, and disease processes, such as arthritis or metastasis. Most MMP's are secreted as inactive proproteins which are activated when cleaved by extracellular proteinases. Matrix metalloproteinase 9 (gelatinase B, 92kDa gelatinase, 92kDa type IV collagenase) (MMP9, synonyms: GELB, CLG4B) degrades collagens type IV and V. Studies in rhesus monkeys suggest that MMP9 is involved in IL-8-induced mobilization hematopoietic progenitor cells from bone marrow, and murine studies suggest a role in tumor-associated tissue remodeling. The pro-MMP9 is 92 kDa, and it can be detected a processed form of 68 kDa. This protein can exist as a dimer of 180 kDa (PMID:7492685).

Protocols

Product Specific Protocols
FC protocol for CL594 MMP-9 (N-terminal) antibody CL594-10375Download protocol
IF protocol for CL594 MMP-9 (N-terminal) antibody CL594-10375Download protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
humanIF

Cancers (Basel)

Tumor-Associated Fibroblast-Derived Exosomal circDennd1b Promotes Pituitary Adenoma Progression by Modulating the miR-145-5p/ONECUT2 Axis and Activating the MAPK Pathway

Authors - Qian Jiang
Loading...
||
New chat

Able

正在加载,请稍候...