• Featured Product
  • KD/KO Validated

MMP-9 (N-terminal) Polyclonal antibody

The MMP-9 (N-terminal) polyclonal antibody (10375-2-AP) is the highest cited MMP-9 (N-terminal) antibody in the market with 1,369 citations.
Cat No. 10375-2-AP
Publications(1369)

Host / Isotype

Rabbit / IgG

Reactivity

human and More (7)

Applications

WB, IHC, IF/ICC, FC (Intra), CoIP, ELISA

MMP9 (N-terminal), MMP9, 67 kDa matrix metalloproteinase-9, 82 kDa matrix metalloproteinase-9, CLG4B

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inJurkat cells, HEK-293 cells, LNCaP cells, U2OS cells, HepG2 cells, Raji cells, MDA-MB-231 cells
Positive IHC detected inhuman breast cancer tissue, human cervical cancer tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF/ICC detected inHepG2 cells
Positive FC (Intra) detected inHeLa cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:500-1:3000
Immunohistochemistry (IHC)IHC : 1:50-1:500
Immunofluorescence (IF)/ICCIF/ICC : 1:200-1:800
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

10375-2-AP targets MMP-9 (N-terminal) in WB, IHC, IF/ICC, FC (Intra), CoIP, ELISA applications and shows reactivity with human samples.

Tested Reactivity human
Cited Reactivityhuman, mouse, rat, pig, rabbit, bovine, hamster, fish
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag0552

Product name: Recombinant human MMP9 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-100 aa of BC006093

Sequence: MSLWQPLVLVLLVLGCCFAAPRQRQSTLVLFPGDLRTNLTDRQLAEEYLYRYGYTRVAEMRGESKSLGPALLLLQKQLSLPETGELDSATLKAMRTPRCG

Predict reactive species
Full Name matrix metallopeptidase 9 (gelatinase B, 92kDa gelatinase, 92kDa type IV collagenase)
Calculated Molecular Weight 707 aa, 78 kDa
Observed Molecular Weight92 kDa, 67 kDa
GenBank Accession NumberBC006093
Gene Symbol MMP-9
Gene ID (NCBI) 4318
RRIDAB_10897178
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDP14780
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Proteins of the matrix metalloproteinase (MMP) family are involved in the breakdown of extracellular matrix in normal physiological processes, such as embryonic development, reproduction, tissue remodeling, and disease processes, such as arthritis or metastasis. Most MMP's are secreted as inactive proproteins which are activated when cleaved by extracellular proteinases. Matrix metalloproteinase 9 (gelatinase B, 92 kDa gelatinase, 92 kDa type IV collagenase) (MMP9, synonyms: GELB, CLG4B) degrades collagens type IV and V. Studies in rhesus monkeys suggest that MMP9 is involved in IL-8-induced mobilization hematopoietic progenitor cells from bone marrow, and murine studies suggest a role in tumor-associated tissue remodeling. The pro-MMP9 is 92 kDa, and it can be detected a processed form of 68 kDa. This protein can exist as a dimer of 180 kDa (PMID:7492685).

Protocols

Product Specific Protocols
FC protocol for MMP-9 (N-terminal) antibody 10375-2-APDownload protocol
IF protocol for MMP-9 (N-terminal) antibody 10375-2-APDownload protocol
IHC protocol for MMP-9 (N-terminal) antibody 10375-2-APDownload protocol
WB protocol for MMP-9 (N-terminal) antibody 10375-2-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
humanWB

Gastroenterology

Regulator of Calcineurin 1 Gene Isoform 4, Downregulated in Hepatocellular Carcinoma, Prevents Proliferation, Migration, and Invasive Activity of Cancer Cells and Growth of Orthotopic Tumors by Inhibiting Nuclear Translocation of NFAT1.

Authors - Haojie Jin
mouseWB,IHC

Cell Host Microbe

Gut microbiome dysbiosis contributes to abdominal aortic aneurysm by promoting neutrophil extracellular trap formation

Authors - Zhenyu Tian
humanWB

Mol Cancer

CircEZH2/miR-133b/IGF2BP2 aggravates colorectal cancer progression via enhancing the stability of m6A-modified CREB1 mRNA.

Authors - Bing Yao
mouseWB

Adv Sci (Weinh)

Bone Marrow-Derived GCA+ Immune Cells Drive Alzheimer's Disease Progression

Authors - Rui Zhou
humanWB,IHC

J Pineal Res

Melatonin modulates metabolic remodeling in HNSCC by suppressing MTHFD1L-formate axis.

Authors - Li Cui
mouseIF

Acta Pharm Sin B

Engineering cannabidiol synergistic carbon monoxide nanocomplexes to enhance cancer therapy via excessive autophagy

Authors - Chang Xiao

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


FH

MALLIKARJUNA (Verified Customer) (11-26-2025)

good for western blot

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:1000
  • Cell Tissue Type: liver tissue
FH

Monica (Verified Customer) (11-14-2025)

Great antibody for detecting MMP9. Gives nice clean bands and works really with 1hr RT incubations as well as over night 4C. Have used the same diluted antibody 4x , and it still giving nice bands.

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:1000
  • Cell Tissue Type: Glomerular endothelial cells
MMP-9 (N-terminal) Antibody Western Blot validation (1:1000 dilution) in Glomerular endothelial cells (Cat no:10375-2-AP)
FH

MALLIKARJUNA (Verified Customer) (11-13-2025)

good for IHC

  • Applications: Immunohistochemistry
  • Primary Antibody Dilution: 1:100
  • Cell Tissue Type: liver tissue
FH

Angie (Verified Customer) (07-24-2024)

A549 lysate was subjected to western blot with MMP9 antibody used at dilution of 1:3000 and incubated at room temperature for 1.5 hours. One strong band (around 92 kDa) was observed.

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:3000
  • Cell Tissue Type: A549
MMP-9 (N-terminal) Antibody Western Blot validation (1:3000 dilution) in A549 (Cat no:10375-2-AP)
FH

Siddharth (Verified Customer) (07-18-2023)

Good antibody for IF experiments

  • Applications: Immunofluorescence
  • Primary Antibody Dilution: 1:500
  • Cell Tissue Type: Primary mesenchymal stromal cells
FH

Christine (Verified Customer) (07-11-2022)

The MMP9 antibody detects nicely a protein with a size of about 100 kD and the blot looks like the blots on the product page

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:1000
  • Cell Tissue Type: mouse macrophage cell line J774
MMP-9 (N-terminal) Antibody Western Blot validation (1:1000 dilution) in mouse macrophage cell line J774 (Cat no:10375-2-AP)
FH

Hongxue (Verified Customer) (01-12-2021)

Clear band for WB

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:1000
  • Cell Tissue Type: Liver
MMP-9 (N-terminal) Antibody Western Blot validation (1:1000 dilution) in Liver (Cat no:10375-2-AP)
FH

Kyosuke (Verified Customer) (06-12-2019)

I am working on aneurysm study and use this for IHC staining on mouse aneurysm section. It works very well.

  • Applications: Immunohistochemistry,
  • Primary Antibody Dilution: 1/100
  • Cell Tissue Type: mouse aorta
FH

JIMMY (Verified Customer) (04-15-2019)

This antibody detects MMP9 expressing cells in the spinal cord of C57BL/6 EAE mice. The imaging is quiet clear with this antibody.

  • Applications: Immunofluorescence,
FH

Lucy (Verified Customer) (03-08-2019)

Reacts mainly to human MMP9 but slightly cross-reactive to human MMP2

  • Applications: Western Blot,
MMP-9 (N-terminal) Antibody Western Blot, validation ( dilution) in (Cat no:10375-2-AP)
Loading...
||
New chat

Able

正在加载,请稍候...