CoraLite® Plus 488-conjugated MMP3 Monoclonal antibody

• 

  IF Staining of A549 using CL488-66338

  Immunofluorescent analysis of (-20°C Ethanol) fixed A549 cells using CoraLite® Plus 488 MMP3 antibody (CL488-66338, Clone: 1F5A9 ) at dilution of 1:200.

• Featured Product
• KD/KO Validated

MMP3 Monoclonal Antibody for IF/ICC

Cat No. CL488-66338

Clone No.1F5A9

Host / Isotype

Mouse / IgG1

Reactivity

human, rat, mouse, pig

Applications

IF/ICC

Synonyms

CHDS6, Matrix metalloproteinase 3, MMP 3, MMP3, SL 1, STMY, STMY1, STR1, Stromelysin 1, Transin 1

---

Tested Applications

• Positive IF/ICC detected in: A549 cells

Recommended dilution

• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

CL488-66338 targets MMP3 in IF/ICC applications and shows reactivity with human, rat, mouse, pig samples.

• Tested Reactivity: human, rat, mouse, pig
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag12359

  Product name: Recombinant human MMP3 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 26-477 aa of BC074869

  Sequence: GEDTSMNLVQKYLENYYDLEKDVKQFVRRKDSGPVVKKIREMQKFLGLEVTGKLDSDTLEVMRKPRCGVPDVGHFRTFPGIPKWRKTHLTYRIVNYTPDLPKDAVDSAVEKALKVWEEVTPLTFSRLYEGEADIMISFAVREHGDFYPFDGPGNVLAHAYAPGPGINGDAHFDDDEQWTKDTTGTNLFLVAAHEIGHSLGLFHSANTEALMYPLYHSLTDLTRFRLSQDDINGIQSLYGPPPDSPETPLVPTEPVPPEPGTPANCDPALSFDAVSTLRGEILIFKDRHFWRKSLRKLEPELHLISSFWPSLPSGVDAAYEVTSKDLVFIFKGNQFWAIRGNEVRAGYPRGIHTLGFPPTVRKIDAAISDKEKNKTYFFVEDKYWRFDEKRNSMEPGFPKQIAEDFPGIDSKIDAVFEEFGFFYFFTGSSQLEFDPNAKKVTHTLKSNSWLNC

• Full Name: matrix metallopeptidase 3 (stromelysin 1, progelatinase)
• Calculated Molecular Weight: 477 aa, 54 kDa
• Observed Molecular Weight: 45-60 kDa
• GenBank Accession Number: BC074869
• Gene Symbol: MMP3
• Gene ID (NCBI): 4314
• RRID: AB_2919311
• Conjugate: CoraLite® Plus 488 Fluorescent Dye
• Excitation/Emission Maxima Wavelengths: 493 nm / 522 nm
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: P08254
• Storage Buffer: PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
• Storage Conditions: Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage.

Background Information

Matrix metalloproteinases (MMPs) play a critically important role in extracellular matrix remodeling and have been implicated in a number of key normal and pathologic processes.These proteases have come to represent important therapeutic and diagnostic targets for the treatment and detection of human cancers. MMP-3 activate procollagenase via two pathways: slow direct activation and rapid activation in conjunction with tissue or plasma proteinases. The pro-MMP3 (60 kDa) and the active MMP3 (47 kDa) can be detected through western blot.