MMP-9 (N-terminal) Polyclonal antibody, PBS Only

• 

  WB analysis using 10375-2-AP (same clone as 10375-2-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 10375-2-AP (MMP9 (N-terminal) antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 10375-2-PBS in a different storage buffer formulation.

• 

  WB analysis using 10375-2-AP (same clone as 10375-2-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 10375-2-AP (MMP-9 (N-terminal) antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 10375-2-PBS in a different storage buffer formulation.

• 

  WB analysis using 10375-2-AP (same clone as 10375-2-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 10375-2-AP (MMP9 (N-terminal) antibody) at dilution of 1:1500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 10375-2-PBS in a different storage buffer formulation.

• 

  WB analysis of U2OS using 10375-2-AP (same clone as 10375-2-PBS)

  WB result of MMP-9 (N-terminal) antibody (10375-2-AP; 1:2000; incubated at room temperature for 1.5 hours) with sh-Control and sh-MMP-9 (N-terminal) transfected U2OS cells. This data was developed using the same antibody clone with 10375-2-PBS in a different storage buffer formulation.

• 

  WB analysis using 10375-2-AP (same clone as 10375-2-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 10375-2-AP (MMP9 (N-terminal) antibody) at dilution of 1:1500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 10375-2-PBS in a different storage buffer formulation.

• 

  IHC staining of human cervical cancer using 10375-2-AP (same clone as 10375-2-PBS)

  Immunohistochemical analysis of paraffin-embedded human cervical cancer tissue slide using 10375-2-AP (MMP9 (N-terminal) antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 10375-2-PBS in a different storage buffer formulation.

• 

  IHC staining of human cervical cancer using 10375-2-AP (same clone as 10375-2-PBS)

  Immunohistochemical analysis of paraffin-embedded human cervical cancer tissue slide using 10375-2-AP (MMP9 (N-terminal) antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 10375-2-PBS in a different storage buffer formulation.

• 

  IHC staining of human breast cancer using 10375-2-AP (same clone as 10375-2-PBS)

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 10375-2-AP (MMP9 (N-terminal) antibody at dilution of 1:200 (under 10x lens). This data was developed using the same antibody clone with 10375-2-PBS in a different storage buffer formulation.

• 

  IHC staining of human breast cancer using 10375-2-AP (same clone as 10375-2-PBS)

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 10375-2-AP (MMP9 (N-terminal) antibody at dilution of 1:200 (under 40x lens). This data was developed using the same antibody clone with 10375-2-PBS in a different storage buffer formulation.

• 

  IHC staining of human breast cancer using 10375-2-AP (same clone as 10375-2-PBS)

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 10375-2-AP (MMP9 (N-terminal) antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 10375-2-PBS in a different storage buffer formulation.

• 

  IHC staining of human breast cancer using 10375-2-AP (same clone as 10375-2-PBS)

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 10375-2-AP (MMP9 (N-terminal) antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 10375-2-PBS in a different storage buffer formulation.

• 

  IHC staining of human breast cancer using 10375-2-AP (same clone as 10375-2-PBS)

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 10375-2-AP (MMP9 (N-terminal) antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 10375-2-PBS in a different storage buffer formulation.

• 

  IHC staining of human cervical cancer using 10375-2-AP (same clone as 10375-2-PBS)

  Immunohistochemical analysis of paraffin-embedded human cervical cancer tissue slide using 10375-2-AP (MMP9 (N-terminal) antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 10375-2-PBS in a different storage buffer formulation.

• 

  IHC staining of human cervical cancer using 10375-2-AP (same clone as 10375-2-PBS)

  Immunohistochemical analysis of paraffin-embedded human cervical cancer tissue slide using 10375-2-AP (MMP9 (N-terminal) antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 10375-2-PBS in a different storage buffer formulation.

• 

  IHC staining of human breast cancer using 10375-2-AP (same clone as 10375-2-PBS)

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 10375-2-AP (MMP9 (N-terminal) antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 10375-2-PBS in a different storage buffer formulation.

• 

  IF Staining of HepG2 using 10375-2-AP (same clone as 10375-2-PBS)

  Immunofluorescent analysis of (-20°C Ethanol) fixed HepG2 cells using MMP9 (N-terminal) antibody (10375-2-AP) at dilution of 1:400 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L), CL594-Phalloidin (red). This data was developed using the same antibody clone with 10375-2-PBS in a different storage buffer formulation.

• 

  FC experiment of HeLa using 10375-2-AP (same clone as 10375-2-PBS)

  1X10^6 HeLa cells were intracellularly stained with 0.4 ug Anti-Human MMP9 (N-terminal) (10375-2-AP) and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L) at dilution 1:1000 (red), or 0.4 ug Control Antibody. Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer. This data was developed using the same antibody clone with 10375-2-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

MMP-9 (N-terminal) Polyclonal Antibody for WB, IHC, IF/ICC, FC (Intra), ELISA

Cat No. 10375-2-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, IF/ICC, FC (Intra), ELISA

Synonyms

MMP9 (N-terminal), MMP9, 67 kDa matrix metalloproteinase-9, 82 kDa matrix metalloproteinase-9, CLG4B

---

Product Information

10375-2-PBS targets MMP-9 (N-terminal) in WB, IHC, IF/ICC, FC (Intra), ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag0552

  Product name: Recombinant human MMP9 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-100 aa of BC006093

  Sequence: MSLWQPLVLVLLVLGCCFAAPRQRQSTLVLFPGDLRTNLTDRQLAEEYLYRYGYTRVAEMRGESKSLGPALLLLQKQLSLPETGELDSATLKAMRTPRCG

• Full Name: matrix metallopeptidase 9 (gelatinase B, 92kDa gelatinase, 92kDa type IV collagenase)
• Calculated Molecular Weight: 707 aa, 78 kDa
• Observed Molecular Weight: 92 kDa, 67 kDa
• GenBank Accession Number: BC006093
• Gene Symbol: MMP-9
• Gene ID (NCBI): 4318
• RRID: AB_10897178
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P14780
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Proteins of the matrix metalloproteinase (MMP) family are involved in the breakdown of extracellular matrix in normal physiological processes, such as embryonic development, reproduction, tissue remodeling, and disease processes, such as arthritis or metastasis. Most MMP's are secreted as inactive proproteins which are activated when cleaved by extracellular proteinases. Matrix metalloproteinase 9 (gelatinase B, 92 kDa gelatinase, 92 kDa type IV collagenase) (MMP9, synonyms: GELB, CLG4B) degrades collagens type IV and V. Studies in rhesus monkeys suggest that MMP9 is involved in IL-8-induced mobilization hematopoietic progenitor cells from bone marrow, and murine studies suggest a role in tumor-associated tissue remodeling. The pro-MMP9 is 92 kDa, and it can be detected a processed form of 68 kDa. This protein can exist as a dimer of 180 kDa (PMID:7492685).