• Featured Product
  • KD/KO Validated

Neprilysin/CD10 Monoclonal antibody

Neprilysin/CD10 Monoclonal Antibody for WB, IHC, ELISA
Cat No. 60034-3-Ig
Clone No.4B9D9

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse, pig, rabbit

Applications

WB, IHC, ELISA

MME, Neprilysin, 4B9D9, Atriopeptidase, CALLA

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inLNCaP cells, Daudi cells, HEK-293 cells, mouse kidney tissue, pig kidney tissue, Ramos cells, A172 cells, rabbit kidney tissue
Positive IHC detected inhuman kidney tissue, human liver tissue, human renal cell carcinoma tissue, human stomach cancer tissue, human tonsil tissue, mouse kidney tissue, mouse liver tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:5000-1:50000
Immunohistochemistry (IHC)IHC : 1:25000-1:100000
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

60034-3-Ig targets Neprilysin/CD10 in WB, IHC, ELISA applications and shows reactivity with human, mouse, pig, rabbit samples.

Tested Reactivity human, mouse, pig, rabbit
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag0427

Product name: Recombinant human MME,CD10 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 52-252 aa of BC101658

Sequence: YDDGICKSSDCIKSAARLIQNMDATTEPCTDFFKYACGGWLKRNVIPETSSRYGNFDILRDELEVVLKDVLQEPKTEDIVAVQKAKALYRSCINESAIDSRGGEPLLKLLPDIYGWPVATENWEQKYGASWTAEKAIAQLNSKYGKKVLINLFVGTDDKNSVNHVIHIDQPRLGLPSRDYYECTGIYKEACTAYVDFMISV

Predict reactive species
Full Name membrane metallo-endopeptidase
Calculated Molecular Weight 750 aa, 86 kDa
Observed Molecular Weight 100 kDa
GenBank Accession NumberBC101658
Gene Symbol CD10
Gene ID (NCBI) 4311
RRIDAB_10641991
Conjugate Unconjugated
FormLiquid
Purification MethodProtein G purification
UNIPROT IDP08473
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

CD10, also known as neprilysin, membrane metallo-endopeptidase (MME), neutral endopeptidase (NEP), or common acute lymphoblastic leukemia antigen (CALLA), is a 100-kDa type II transmembrane glycoprotein belonging to peptidase M13 family (PMID: 7760013; 8102558). Among hematopoietic cells, CD10 is expressed on granulocytes, B cell precursors, mature germinal center B cells, a subset of immature thymocytes (PMID: 13679451). CD10 is also expressed on a variety of nonhematopoietic cell types, including bronchial epithelial cells, cultured fibroblasts, bone marrow stromal cells, renal proximal tubular epithelial cells, breast myoepithelium, biliary canaliculi (PMID: 8102558). CD10 is a cell surface peptidase that cleaves peptide bonds on the amino side of hydrophobic amino acids and inactivates a variety of physiologically active peptides. Loss or decreases in CD10 expression have been reported in a variety of malignancies (PMID: 16054017).

Protocols

Product Specific Protocols
IHC protocol for Neprilysin/CD10 antibody 60034-3-IgDownload protocol
WB protocol for Neprilysin/CD10 antibody 60034-3-IgDownload protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...