Filter: AllWBIHC

WB analysis using 60034-3-Ig
Various lysates were subjected to SDS PAGE followed by western blot with 60034-3-Ig (Neprilysin/CD10 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.
WB analysis of Daudi using 60034-3-Ig
Daudi cells were subjected to SDS PAGE followed by western blot with 60034-3-Ig (Neprilysin/CD10 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.
WB analysis using 60034-3-Ig
Various lysates were subjected to SDS PAGE followed by western blot with 60034-3-Ig (Neprilysin/CD10 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.
WB analysis of HEK-293 using 60034-3-Ig
WB result of Neprilysin/CD10 antibody (60034-3-Ig; 1:1000; incubated at room temperature for 1.5 hours) with sh-Control and sh-Neprilysin/CD10 transfected HEK-293 cells.
WB analysis of Ramos using 60034-3-Ig
Ramos cells were subjected to SDS PAGE followed by western blot with 60034-3-Ig (Neprilysin/CD10 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.
WB analysis of pig kidney using 60034-3-Ig
pig kidney tissue were subjected to SDS PAGE followed by western blot with 60034-3-Ig (Neprilysin/CD10 Antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.
WB analysis of mouse kidney using 60034-3-Ig
mouse kidney tissue were subjected to SDS PAGE followed by western blot with 60034-3-Ig (Neprilysin/CD10 Antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.
IHC staining of human kidney using 60034-3-Ig
Immunohistochemical analysis of paraffin-embedded human kidney tissue slide using 60034-3-Ig (Neprilysin/CD10 antibody) at dilution of 1:50000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
IHC staining of human kidney using 60034-3-Ig
Immunohistochemical analysis of paraffin-embedded human kidney tissue slide using 60034-3-Ig (Neprilysin/CD10 antibody) at dilution of 1:50000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
IHC staining of human kidney using 60034-3-Ig
Immunohistochemical analysis of paraffin-embedded human kidney tissue slide using 60034-3-Ig (Neprilysin/CD10 antibody) at dilution of 1:100000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
IHC staining of human stomach cancer using 60034-3-Ig
Immunohistochemical analysis of paraffin-embedded human stomach cancer tissue slide using 60034-3-Ig (Neprilysin/CD10 antibody) at dilution of 1:50000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
IHC staining of human stomach cancer using 60034-3-Ig
Immunohistochemical analysis of paraffin-embedded human stomach cancer tissue slide using 60034-3-Ig (Neprilysin/CD10 antibody) at dilution of 1:50000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
IHC staining of human renal cell carcinoma using 60034-3-Ig
Immunohistochemical analysis of paraffin-embedded human renal cell carcinoma tissue slide using 60034-3-Ig (Neprilysin/CD10 antibody) at dilution of 1:100000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
IHC staining of human kidney using 60034-3-Ig
Immunohistochemical analysis of paraffin-embedded human kidney tissue slide using 60034-3-Ig (Neprilysin/CD10 antibody) at dilution of 1:100000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
IHC staining of human liver using 60034-3-Ig
Immunohistochemical analysis of paraffin-embedded human liver tissue slide using 60034-3-Ig (Neprilysin/CD10 antibody) at dilution of 1:50000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
IHC staining of human liver using 60034-3-Ig
Immunohistochemical analysis of paraffin-embedded human liver tissue slide using 60034-3-Ig (Neprilysin/CD10 antibody) at dilution of 1:50000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
IHC staining of human renal cell carcinoma using 60034-3-Ig
Immunohistochemical analysis of paraffin-embedded human renal cell carcinoma tissue slide using 60034-3-Ig (Neprilysin/CD10 antibody) at dilution of 1:100000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
IHC staining of mouse kidney using 60034-3-Ig
Immunohistochemical analysis of paraffin-embedded mouse kidney tissue slide using 60034-3-Ig (Neprilysin/CD10 Antibody) at dilution of 1:400 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
IHC staining of mouse kidney using 60034-3-Ig
Immunohistochemical analysis of paraffin-embedded mouse kidney tissue slide using 60034-3-Ig (Neprilysin/CD10 Antibody) at dilution of 1:400 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
IHC staining of mouse liver using 60034-3-Ig
Immunohistochemical analysis of paraffin-embedded mouse liver tissue slide using 60034-3-Ig (Neprilysin/CD10 Antibody) at dilution of 1:400 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
IHC staining of mouse liver using 60034-3-Ig
Immunohistochemical analysis of paraffin-embedded mouse liver tissue slide using 60034-3-Ig (Neprilysin/CD10 Antibody) at dilution of 1:400 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
IHC staining of human tonsil using 60034-3-Ig
Immunohistochemical analysis of paraffin-embedded human tonsil using 60034-3-Ig(Neprilysin/CD10 antibody) at dilution of 1:100 (under 10x lens).
IHC staining of human tonsil using 60034-3-Ig
Immunohistochemical analysis of paraffin-embedded human tonsil using 60034-3-Ig(Neprilysin/CD10 antibody) at dilution of 1:100 (under 40x lens).

Featured Product
KD/KO Validated

Neprilysin/CD10 Monoclonal antibody

Name: Neprilysin/CD10 Monoclonal antibody
Brand: Proteintech
SKU: 60034-3-Ig

Neprilysin/CD10 Monoclonal Antibody for WB, IHC, ELISA

Cat No. 60034-3-Ig

Clone No.4B9D9

Review Product

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse, pig, rabbit

Applications

WB, IHC, ELISA

Synonyms

MME, Neprilysin, 4B9D9, Atriopeptidase, CALLA

Formulation: PBS, Azide, Glycerol

PBS, Azide, Glycerol

PBS Only

Conjugate: Unconjugated

Unconjugated

Size/Concentration:

-/ -

Freight/Packing: -

Quantity

- +

Request bulk or custom quote

Proteintech Guarantee

Overview

Tested Applications
Product Information
Protocols

Print datasheet

MSDS SDS

Tested Applications

Positive WB detected in	LNCaP cells, Daudi cells, HEK-293 cells, mouse kidney tissue, pig kidney tissue, Ramos cells, A172 cells, rabbit kidney tissue
Positive IHC detected in	human kidney tissue, human liver tissue, human renal cell carcinoma tissue, human stomach cancer tissue, human tonsil tissue, mouse kidney tissue, mouse liver tissue **Note: suggested antigen retrieval with TE buffer pH 9.0; () Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0***

Recommended dilution

Application	Dilution
Western Blot (WB)	WB : 1:5000-1:50000
Immunohistochemistry (IHC)	IHC : 1:25000-1:100000
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

60034-3-Ig targets Neprilysin/CD10 in WB, IHC, ELISA applications and shows reactivity with human, mouse, pig, rabbit samples.

Tested Reactivity	human, mouse, pig, rabbit
Host / Isotype	Mouse / IgG1
Class	Monoclonal
Type	Antibody
Immunogen	CatNo: Ag0427 Product name: Recombinant human MME,CD10 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 52-252 aa of BC101658 Sequence: YDDGICKSSDCIKSAARLIQNMDATTEPCTDFFKYACGGWLKRNVIPETSSRYGNFDILRDELEVVLKDVLQEPKTEDIVAVQKAKALYRSCINESAIDSRGGEPLLKLLPDIYGWPVATENWEQKYGASWTAEKAIAQLNSKYGKKVLINLFVGTDDKNSVNHVIHIDQPRLGLPSRDYYECTGIYKEACTAYVDFMISV Predict reactive species
Full Name	membrane metallo-endopeptidase
Calculated Molecular Weight	750 aa, 86 kDa
Observed Molecular Weight	100 kDa
GenBank Accession Number	BC101658
Gene Symbol	CD10
Gene ID (NCBI)	4311
RRID	AB_10641991
Conjugate	Unconjugated
Form	Liquid
Purification Method	Protein G purification
UNIPROT ID	P08473
Storage Buffer	PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions	Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

CD10, also known as neprilysin, membrane metallo-endopeptidase (MME), neutral endopeptidase (NEP), or common acute lymphoblastic leukemia antigen (CALLA), is a 100-kDa type II transmembrane glycoprotein belonging to peptidase M13 family (PMID: 7760013; 8102558). Among hematopoietic cells, CD10 is expressed on granulocytes, B cell precursors, mature germinal center B cells, a subset of immature thymocytes (PMID: 13679451). CD10 is also expressed on a variety of nonhematopoietic cell types, including bronchial epithelial cells, cultured fibroblasts, bone marrow stromal cells, renal proximal tubular epithelial cells, breast myoepithelium, biliary canaliculi (PMID: 8102558). CD10 is a cell surface peptidase that cleaves peptide bonds on the amino side of hydrophobic amino acids and inactivates a variety of physiologically active peptides. Loss or decreases in CD10 expression have been reported in a variety of malignancies (PMID: 16054017).