LMX1B Polyclonal antibody, PBS Only

• 

  WB analysis of HeLa using 18278-1-AP (same clone as 18278-1-PBS)

  HeLa cells were subjected to SDS PAGE followed by western blot with 18278-1-AP (LMX1B antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 18278-1-PBS in a different storage buffer formulation.

• 

  IF Staining of embryonic kidney tissue using 18278-1-AP (same clone as 18278-1-PBS)

  IF result of anti-LMX1B (18278-1-AP ,1:900) with embryonic kidney by Dr. Joo-Seop Park. Red: Podocytes, anti-rabbir Alexa555; Blue: Hoechst. This data was developed using the same antibody clone with 18278-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

LMX1B Polyclonal Antibody for WB, IF, Indirect ELISA

Cat No. 18278-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IF, Indirect ELISA

Synonyms

LIM homeobox transcription factor 1-beta, LMX 1.2, LMX1, LMX1.2, LMX-1.2

---

Product Information

18278-1-PBS targets LMX1B in WB, IF, Indirect ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag13096

  Product name: Recombinant human LMX1B protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-372 aa of BC112120

  Sequence: MLDGIKMEEHALRPGPATLGVLLGSDCPHPAVCEGCQRPISDRFLMRVNESSWHEECLQCAACQQALTTSCYFRDRKLYCKQDYQQLFAAKCSGCMEKIAPTEFVMRALECVYHLGCFCCCVCERQLRKGDEFVLKEGQLLCKGDYEKEKDLLSSVSPDESDSVKSEDEDGDMKPAKGQGSQSKGSGDDGKDPRRPKRPRTILTTQQRRAFKASFEVSSKPCRKVRETLAAETGLSVRVVQVWFQNQRAKMKKLARRHQQQQEQQNSQRLGQEVLSSRMEGMMASYTPLAPPQQQIVAMEQSPYGSSDPFQQGLTPPQMPGNDSIFHDIDSDTSLTSLSDCFLGSSDVGSLQARVGNPIDRLYSMQSSYFAS

• Full Name: LIM homeobox transcription factor 1, beta
• Calculated Molecular Weight: 372 aa, 42 kDa
• Observed Molecular Weight: 42-45 kDa
• GenBank Accession Number: BC112120
• Gene Symbol: LMX1B
• Gene ID (NCBI): 4010
• RRID: AB_11232226
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: O60663
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

LMX1B, LIM homeodomain factor 1b, functions as a transcription factor, and is essential for the normal development of dorsal limb structures, the glomerular basement membrane, the anterior segment of the eye, and dopaminergic and serotonergic neurons. Lmx1b is a continuously expressed, terminal selector-type factor in 5-HT neurons. It is required for maintenance of central serotonergic neurons (PMID: 17151281, PMID: 14602809). It is expressed in brain, testis, skeletal muscle, and pancreatic islets (PMID: 35417751, PMID: 18512225).