• Featured Product
  • KD/KO Validated

Cytokeratin 13 Recombinant monoclonal antibody, PBS Only (Capture)

Cytokeratin 13 Uni-rAb® Recombinant Antibody for WB, IHC, IF/ICC, IF-P, Sandwich ELISA, Indirect ELISA, Sample test
Cat No. 83058-1-PBS
Clone No.230366B10

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, IF-P, Sandwich ELISA, Indirect ELISA, Sample test

KRT13, 230366B10, CK 13, CK13, CK-13

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

83058-1-PBS targets Cytokeratin 13 as part of a matched antibody pair:

MP00074-2: 83058-1-PBS capture and 83058-5-PBS detection (validated in Sandwich ELISA)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

Tested Reactivity human, mouse, rat
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag0217

Product name: Recombinant human KRT13 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 183-458 aa of BC002661

Sequence: ARLAVDDFRLKYENELALRQSVEADINGLRRVLDELTLSKTDLEMQIESLNEELAYMKKNHEEEMKEFSNQVVGQVNVEMDATPGIDLTRVLAEMREQYEAMAERNRRDAEEWFHAKSAELNKEVSTNTAMIQTSKTEITELRRTLQGLEIELQSQLSMKAGLENTVAETECRYALQLQQIQGLISSIEAQLSELRSEMECQNQEYKMLLDIKTRLEQEIATYRSLLEGQDAKMIGFPSSAGSVSPRSTSVTTTSSASVTTTSNASGRRTSDVRRP

Predict reactive species
Full Name keratin 13
Calculated Molecular Weight 50 kDa
Observed Molecular Weight50 kDa
GenBank Accession NumberBC002661
Gene Symbol Cytokeratin 13
Gene ID (NCBI) 3860
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP13646
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

Keratin 13 is a member of the keratin family. The keratins are intermediate filament proteins responsible for the structural integrity of epithelial cells and are subdivided into cytokeratins and hair keratins. Most of the type I cytokeratins consist of acidic proteins which are arranged in pairs of heterotypic keratin chains. This type I cytokeratin is paired with keratin 4 and expressed in the suprabasal layers of non-cornified stratified epithelia. Mutations in keratin 13 gene and keratin 4 have been associated with the autosomal dominant disorder White Sponge Nevus. The type I cytokeratins are clustered in a region of chromosome 17q21.2.

Loading...
||
New chat

Able

正在加载,请稍候...