• Featured Product
  • KD/KO Validated

Cytokeratin 13 Recombinant monoclonal antibody

Cytokeratin 13 Uni-rAb® Recombinant Antibody for WB, IHC, IF/ICC, IF-P, ELISA
Cat No. 83058-1-RR
Clone No.230366B10

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, IF-P, ELISA

KRT13, 230366B10, CK 13, CK13, CK-13

Formulation:  PBS and Azide
PBS and Azide
PBS Only
Conjugate:  Unconjugated
Unconjugated
CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inHaCaT cells, A431 cells, mouse skin tissue, rat skin tissue, rat thymus tissue
Positive IHC detected inhuman urothelial carcinoma tissue, human cervical squamous cancer tissue, human oesophagus cancer tissue, mouse skin tissue, rat skin tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF-P detected inmouse skin tissue
Positive IF/ICC detected inHaCaT cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:2000-1:16000
Immunohistochemistry (IHC)IHC : 1:500-1:2000
Immunofluorescence (IF)-PIF-P : 1:50-1:500
Immunofluorescence (IF)/ICCIF/ICC : 1:200-1:800
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

83058-1-RR targets Cytokeratin 13 in WB, IHC, IF/ICC, IF-P, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag0217

Product name: Recombinant human KRT13 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 183-458 aa of BC002661

Sequence: ARLAVDDFRLKYENELALRQSVEADINGLRRVLDELTLSKTDLEMQIESLNEELAYMKKNHEEEMKEFSNQVVGQVNVEMDATPGIDLTRVLAEMREQYEAMAERNRRDAEEWFHAKSAELNKEVSTNTAMIQTSKTEITELRRTLQGLEIELQSQLSMKAGLENTVAETECRYALQLQQIQGLISSIEAQLSELRSEMECQNQEYKMLLDIKTRLEQEIATYRSLLEGQDAKMIGFPSSAGSVSPRSTSVTTTSSASVTTTSNASGRRTSDVRRP

Predict reactive species
Full Name keratin 13
Calculated Molecular Weight 50 kDa
Observed Molecular Weight50 kDa
GenBank Accession NumberBC002661
Gene Symbol Cytokeratin 13
Gene ID (NCBI) 3860
RRIDAB_3670785
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP13646
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Keratin 13 is a member of the keratin family. The keratins are intermediate filament proteins responsible for the structural integrity of epithelial cells and are subdivided into cytokeratins and hair keratins. Most of the type I cytokeratins consist of acidic proteins which are arranged in pairs of heterotypic keratin chains. This type I cytokeratin is paired with keratin 4 and expressed in the suprabasal layers of non-cornified stratified epithelia. Mutations in keratin 13 gene and keratin 4 have been associated with the autosomal dominant disorder White Sponge Nevus. The type I cytokeratins are clustered in a region of chromosome 17q21.2.

Protocols

Product Specific Protocols
WB protocol for Cytokeratin 13 antibody 83058-1-RRDownload protocol
IHC protocol for Cytokeratin 13 antibody 83058-1-RRDownload protocol
IF protocol for Cytokeratin 13 antibody 83058-1-RRDownload protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...