KLK3/PSA Recombinant monoclonal antibody, PBS Only

KLK3/PSA Uni-rAb® Recombinant Antibody for WB, IHC, IF/ICC, FC (Intra), Indirect ELISA
Cat No. 84059-5-PBS
Clone No.241263F8

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, IF/ICC, FC (Intra), Indirect ELISA

KLK3, 241263F8, APS, EC:3.4.21.77, Gamma-seminoprotein

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

84059-5-PBS targets KLK3/PSA in WB, IHC, IF/ICC, FC (Intra), Indirect ELISA applications and shows reactivity with human samples.

Tested Reactivity human
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Eg0869

Product name: Recombinant Human KLK3/PSA protein (His Tag)

Source: mammalian cells-derived, pHZ-KIsec-C-6*HIS

Tag: C-10*His

Domain: 18-261 aa of NM_001648.2

Sequence: APLILSRIVGGWECEKHSQPWQVLVASRGRAVCGGVLVHPQWVLTAAHCIRNKSVILLGRHSLFHPEDTGQVFQVSHSFPHPLYDMSLLKNRFLRPGDDSSHDLMLLRLSEPAELTDAVKVMDLPTQEPALGTTCYASGWGSIEPEEFLTPKKLQCVDLHVISNDVCAQVHPQKVTKFMLCAGRWTGGKSTCSGDSGGPLVCNGVLQGITSWGSEPCALPERPSLYTKVVHYRKWIKDTIVANP

Predict reactive species
Full Name kallikrein-related peptidase 3
Calculated Molecular Weight29 kDa
Observed Molecular Weight 30-34 kDa
GenBank Accession NumberNM_001648.2
Gene Symbol KLK3
Gene ID (NCBI) 354
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purfication
UNIPROT IDP07288-1
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

KLK3 also known as Prostate-Specific Antigen (PSA), is a 33 kDa glycoprotein primarily synthesized by the epithelial cells of the prostate gland. Its main physiological function is to cleave seminogelins I and II in semen, leading to the liquefaction of the seminal coagulum and the release of motile sperm. It is under tight regulation by androgens via the androgen receptor (AR). Serum PSA levels are elevated in prostate cancer due to disruption of the glandular architecture, allowing more PSA to enter the bloodstream. It is used alongside digital rectal exam (DRE) for early detection. Although termed "prostate-specific," PSA is not exclusively produced by the prostate. Very low levels can be produced in periurethral glands, breast tissue, and some other tissues. Its expression is highly abundant in prostatic tissue and seminal fluid.

Loading...
||
New chat

Able

正在加载,请稍候...