• Featured Product
  • KD/KO Validated

CoraLite® Plus 488-conjugated KGA-Specific Polyclonal antibody

KGA-Specific Polyclonal Antibody for IF/ICC
Cat No. CL488-20170

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

IF/ICC

AAD20, DKFZp686O15119, FLJ10358, GAC, GLS, GLS1, glutaminase, K glutaminase, KIAA0838, L glutamine amidohydrolase

Formulation:  PBS and Azide
PBS and Azide
Conjugate:  CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IF/ICC detected inHEK-293 cells

Recommended dilution

ApplicationDilution
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL488-20170 targets KGA-Specific in IF/ICC applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag14002

Product name: Recombinant human GLS protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 616-669 aa of BC038507

Sequence: KDRWNNTPMDEALHFGHHDVFKILQEYQVQYTPQGDSDNGKENQTVHKNLDGLL

Predict reactive species
Full Name glutaminase
Calculated Molecular Weight 669 aa, 73 kDa
Observed Molecular Weight 66 kDa
GenBank Accession NumberBC038507
Gene Symbol GLS
Gene ID (NCBI) 2744
RRIDAB_3084030
Conjugate CoraLite® Plus 488 Fluorescent Dye
Excitation/Emission Maxima Wavelengths493 nm / 522 nm
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDO94925
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

GLS, also named as GLS1 and KIAA0838, belongs to the glutaminase family. It catalyzes the first reaction in the primary pathway for the renal catabolism of glutamine. Glutaminase-, glutamate-, and taurine-immunoreactive neurons develop neurofibrillary tangles in Alzheimer's disease.The glutaminase band in AA/C1 cells is more intense than in HT29 cells, in accordance with measurements of glutaminase activity, and had the same molecular mass of approx 63 kDa. The bands for both cell lines are clearly different in size from both rat liver glutaminase (58 kDa) and rat kidney glutaminase (65 kDa)(PMID:12408749). It also reveals a molecular weight of 83-84 kDa as a phosphate-dependent glutaminase(PMID:447624;7512428). It has 3 isoforms produced by alternative splicing named as KGA, GAM, GAC. This antibody is specific to KGA.

Protocols

Product Specific Protocols
IF protocol for CL Plus 488 KGA-Specific antibody CL488-20170Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...