• Featured Product
  • KD/KO Validated

CoraLite® Plus 488-conjugated KGA/GAM/GAC Polyclonal antibody

KGA/GAM/GAC Polyclonal Antibody for IF/ICC
Cat No. CL488-23549

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

IF/ICC

AAD20, GAC, GAM, GLS, GLS1, glutaminase, K glutaminase, KGA, KGA/GAM/GAC, KIAA0838, L glutamine amidohydrolase

Formulation:  PBS and Azide
PBS and Azide
Conjugate:  CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IF/ICC detected inHeLa cells

Recommended dilution

ApplicationDilution
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL488-23549 targets KGA/GAM/GAC in IF/ICC applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag20354

Product name: Recombinant human GLS protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-140 aa of BC038507

Sequence: MMRLRGSGMLRDLLLRSPAGVSATLRRAQPLVTLCRRPRGGGRPAAGPAAAARLHPWWGGGGWPAEPLARGLSSSPSEILQELGKGSTHPQPGVSPPAAPAAPGPKDGPGETDAFGNSEGKELVASGENKIKQGLLPSLE

Predict reactive species
Full Name glutaminase
Calculated Molecular Weight 669 aa, 73 kDa
Observed Molecular Weight 58 kDa, 65 kDa, 83 kDa
GenBank Accession NumberBC038507
Gene Symbol GLS
Gene ID (NCBI) 2744
RRIDAB_3672756
Conjugate CoraLite® Plus 488 Fluorescent Dye
Excitation/Emission Maxima Wavelengths493 nm / 522 nm
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDO94925
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

GLS, also named as GLS1 and KIAA0838, belongs to the glutaminase family. It catalyzes the first reaction in the primary pathway for the renal catabolism of glutamine. Glutaminase-, glutamate-, and taurine-immunoreactive neurons develop neurofibrillary tangles in Alzheimer's disease.The glutaminase band in AA/C1 cells is more intense than in HT29 cells, in accordance with measurements of glutaminase activity, and had the same molecular mass of approx. 63 kDa(PMID:12408749). Ping Gao et al. (2009) determined that mitochondrial glutaminase expression (GLS, molecular mass of ~58 kDa) is increased ~10-fold in response to Myc. It also reveals a molecular weight of 83-84 kDa as a phosphate-dependent glutaminase(PMID:447624;7512428). GLS has 3 isoforms produced by alternative splicing and this antibody can recognize all the 3 isoforms(KGA,GAM,GAC) of GLS.

Protocols

Product Specific Protocols
IF protocol for CL Plus 488 KGA/GAM/GAC antibody CL488-23549Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...