JUN Polyclonal antibody

• 

  WB analysis using 24909-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 24909-1-AP (JUN antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human lung squamous cell cancer using 24909-1-AP

  Immunohistochemical analysis of paraffin-embedded human lung squamous cell cancer slide using 24909-1-AP (JUN antibody) at dilution of 1:1000 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human lung squamous cell cancer using 24909-1-AP

  Immunohistochemical analysis of paraffin-embedded human lung squamous cell cancer slide using 24909-1-AP (JUN antibody) at dilution of 1:1000 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of NIH/3T3 using 24909-1-AP

  Immunofluorescent analysis of (4% PFA) fixed NIH/3T3 cells using JUN antibody (24909-1-AP) at dilution of 1:200 and CoraLite®594-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-4), CL488-phalloidin (green).

• 

  FC experiment of NIH/3T3 using 24909-1-AP

  1X10^6 NIH/3T3 cells were intracellularly stained with 0.2 ug Anti-Human JUN (24909-1-AP) and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L) at dilution 1:1000 (red), or 0.2 ug Control Antibody. Cells were fixed and permeabilized with Transcription Factor Staining Buffer Kit (PF00011).

• Featured Product
• KD/KO Validated

JUN Polyclonal Antibody for WB, IHC, IF/ICC, FC (Intra), ELISA

Cat No. 24909-1-AP

Publications(96)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, hamster and More (2)

Applications

WB, IHC, IF/ICC, FC (Intra), IP, CoIP, ChIP, ELISA

Synonyms

AP 1, AP1, Activator protein 1, c Jun, jun oncogene

---

Tested Applications

• Positive WB detected in: UV treated HeLa cells, C6 cells, HEK-293 cells, HeLa cells, NIH/3T3 cells, UV treated NIH/3T3 cells, HepG2 cells
• Positive IHC detected in: human lung squamous cell cancer; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: NIH/3T3 cells
• Positive FC (Intra) detected in: NIH/3T3 cells

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:6000
• Immunohistochemistry (IHC): IHC : 1:500-1:2000
• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500
• Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.20 ug per 10^6 cells in a 100 µl suspension

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• KD/KO: See 4 publications below
• WB: See 81 publications below
• IHC: See 6 publications below
• IF: See 17 publications below
• IP: See 3 publications below
• CoIP: See 2 publications below
• ChIP: See 6 publications below

Product Information

24909-1-AP targets JUN in WB, IHC, IF/ICC, FC (Intra), IP, CoIP, ChIP, ELISA applications and shows reactivity with human, mouse, hamster samples.

• Tested Reactivity: human, mouse, hamster
• Cited Reactivity: human, mouse, rat, chicken
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag17639

  Product name: Recombinant human JUN protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 92-227 aa of BC068522

  Sequence: PTPTQFLCPKNVTDEQEGFAEGFVRALAELHSQNTLPSVTSAAQPVNGAGMVAPAVASVAGGSGSGGFSASLHSEPPVYANLSNFNPGALSSGGGAPSYGAAGLAFPAQPQQQQQPPHHLPQQMPVQHPRLQALKE

• Full Name: jun oncogene
• Calculated Molecular Weight: 331 aa, 36 kDa
• Observed Molecular Weight: 39 kDa
• GenBank Accession Number: BC068522
• Gene Symbol: JUN
• Gene ID (NCBI): 3725
• RRID: AB_2860574
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P05412
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

JUN is also named as c-Jun and AP1, belongs to the bZIP family and Jun subfamily. JUN, the most extensively studied protein of the activator protein-1 (AP-1) complex, is involved in numerous cell activities, such as proliferation, apoptosis, survival, tumorigenesis and tissue morphogenesis[PMID: 22180088]. JUN is a transcription factor that recognizes and binds to the enhancer heptamer motif 5'-TGA[CG]TCA-3'. It promotes activity of NR5A1 when phosphorylated by HIPK3 leading to increased steroidogenic gene expression upon cAMP signaling pathway stimulation. JUN is a basic leucine zipper (bZIP) transcription factor that acts as homo- or heterodimer, binding to DNA and regulating gene transcription[PMID: 9732876]. In additon, extracellular signals can induce post-translational modifications of JUN, resulting in altered transcriptional activity and target gene expression[PMID:8464713]. More over, it has uncovered multiple layers of a complex regulatory scheme in which JUN is able to crosstalk, amplify and integrate different signals for tissue development and disease. Jun is predominantly nuclear, ubiquitinated Jun colocalizes with lysosomal proteins[PMID: 15469925]. This antibody is a rabbit polyclonal antibody raised against a region of human JUN. Both phosphorylated (p-c-Jun) and unphosphorylated forms of c-Jun, with sizes of 42-45 kDa and 36-39 kDa, respectively are obtain in some experiments. (PMID: 17210646)

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	IF	Nature; Mechanisms of stretch-mediated skin expansion at single-cell resolution.; Authors - Mariaceleste Aragona
human	WB	Cell Metab; CircACC1 Regulates Assembly and Activation of AMPK Complex under Metabolic Stress.; Authors - Qidong Li ; KD Validated
human,mouse	WB	Cell Host Microbe; Veillonella intestinal colonization promotes C. difficile infection in Crohn's disease; Authors - Ziyu Yang
human	IF	Biomaterials; Material-driven immunomodulation and ECM remodeling reverse pulmonary fibrosis by local delivery of stem cell-laden microcapsules; Authors - Yujie Zhang
human	WB,IP	Nat Commun; Proteomic profiling and genome-wide mapping of O-GlcNAc chromatin-associated proteins reveal an O-GlcNAc-regulated genotoxic stress response.; Authors - Yubo Liu
human	WB	Nat Commun; TNF antagonist sensitizes synovial fibroblasts to ferroptotic cell death in collagen-induced arthritis mouse models.; Authors - Jiao Wu