• Featured Product
  • KD/KO Validated

IL-4 Monoclonal antibody, PBS Only

IL-4 antibodies are versatile tools for investigating IL-4’s roles in immunity, allergy, autoimmunity, and cancer, supporting a wide range of molecular, cellular, and functional assays. Proteintech has an extensive range of validated IL-4 antibodies antibodies for WB, IHC, IF-P, ELISA and more.
Cat No. 66142-1-PBS
Clone No.1G2C5

Host / Isotype

Mouse / IgG2a

Reactivity

human, pig

Applications

WB, IHC, IF-P, FC (Intra), ELISA

IL4, 1G2C5, B-cell stimulatory factor 1, BSF-1, IL 4

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

66142-1-PBS targets IL-4 in WB, IHC, IF-P, FC (Intra), ELISA applications and shows reactivity with human, pig samples.

Tested Reactivity human, pig
Host / Isotype Mouse / IgG2a
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag9940

Product name: Recombinant human IL-4 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 24-153 aa of BC070123

Sequence: GHKCDITLQEIIKTLNSLTEQKTLCTELTVTDIFAASKNTTEKETFCRAATVLRQFYSHHEKDTRCLGATAQQFHRHKQLIRFLKRLDRNLWGLAGLNSCPVKEANQSTLENFLERLKTIMREKYSKCSS

Predict reactive species
Full Name interleukin 4
Calculated Molecular Weight 153 aa, 17 kDa
Observed Molecular Weight 18 kDa
GenBank Accession NumberBC070123
Gene Symbol IL-4
Gene ID (NCBI) 3565
RRIDAB_2881539
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP05112
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

IL4 is a cytokine produced by CD4+ T cells in response to helminthes and other extracellular parasites. It promotes the proliferation and differentiation of antigen presenting cells. IL4 also plays a pivotal role in antibody isotype switching and stimulates the production of IgE. This cytokine has been applied in the treatment of autoimmune disorder like multiple myeloma, cancer, psoriasis, and arthritis. IL4 has also been extensively applied to inhibit detrimental effect of Th1. It may promote the growth of epithelial tumors by mediating increased proliferation and survival.

Loading...
||
New chat

Able

正在加载,请稍候...