Tested Applications
Positive WB detected in | Jurkat cells |
Positive IHC detected in | human tonsillitis tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Positive IF-P detected in | human breast cancer tissue |
Positive FC (Intra) detected in | Ramos cells |
Recommended dilution
Application | Dilution |
---|---|
Western Blot (WB) | WB : 1:500-1:2000 |
Immunohistochemistry (IHC) | IHC : 1:20-1:200 |
Immunofluorescence (IF)-P | IF-P : 1:200-1:800 |
Flow Cytometry (FC) (INTRA) | FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Published Applications
KD/KO | See 1 publications below |
WB | See 35 publications below |
IHC | See 17 publications below |
IF | See 11 publications below |
ELISA | See 1 publications below |
Product Information
66142-1-Ig targets IL-4 in WB, IHC, IF-P, FC (Intra), ELISA applications and shows reactivity with human, pig samples.
Tested Reactivity | human, pig |
Cited Reactivity | human, mouse, rat, pig, bovine |
Host / Isotype | Mouse / IgG2a |
Class | Monoclonal |
Type | Antibody |
Immunogen |
CatNo: Ag9940 Product name: Recombinant human IL-4 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 24-153 aa of BC070123 Sequence: GHKCDITLQEIIKTLNSLTEQKTLCTELTVTDIFAASKNTTEKETFCRAATVLRQFYSHHEKDTRCLGATAQQFHRHKQLIRFLKRLDRNLWGLAGLNSCPVKEANQSTLENFLERLKTIMREKYSKCSS Predict reactive species |
Full Name | interleukin 4 |
Calculated Molecular Weight | 153 aa, 17 kDa |
Observed Molecular Weight | 18 kDa |
GenBank Accession Number | BC070123 |
Gene Symbol | IL-4 |
Gene ID (NCBI) | 3565 |
RRID | AB_2881539 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Protein A purification |
UNIPROT ID | P05112 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
IL4 is a cytokine produced by CD4+ T cells in response to helminthes and other extracellular parasites. It promotes the proliferation and differentiation of antigen presenting cells. IL4 also plays a pivotal role in antibody isotype switching and stimulates the production of IgE. This cytokine has been applied in the treatment of autoimmune disorder like multiple myeloma, cancer, psoriasis, and arthritis. IL4 has also been extensively applied to inhibit detrimental effect of Th1. It may promote the growth of epithelial tumors by mediating increased proliferation and survival.
Protocols
Product Specific Protocols | |
---|---|
WB protocol for IL-4 antibody 66142-1-Ig | Download protocol |
IHC protocol for IL-4 antibody 66142-1-Ig | Download protocol |
IF protocol for IL-4 antibody 66142-1-Ig | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |
Publications
Species | Application | Title |
---|---|---|
Adv Healthc Mater One-Step Synthesis of Multifunctional Chitosan Hydrogel for Full-Thickness Wound Closure and Healing. | ||
Aging (Albany NY) Integrative transcriptomic and metabonomic profiling analyses reveal the molecular mechanism of Chinese traditional medicine huankuile suspension on TNBS-induced ulcerative colitis. | ||
Transl Stroke Res Beneficial Effects of Theta-Burst Transcranial Magnetic Stimulation on Stroke Injury via Improving Neuronal Microenvironment and Mitochondrial Integrity. | ||
Int Immunopharmacol Favipiravir ameliorates bleomycin-induced pulmonary fibrosis by reprogramming M1/M2 macrophage polarization | ||
Int Immunopharmacol Emu oil alleviates atopic dermatitis-like responses by inhibiting Cdc42 signaling of keratinocyte | ||
Front Cell Dev Biol Intravenous AAV9 administration results in safe and widespread distribution of transgene in the brain of mini-pig |