Tested Applications
| Positive WB detected in | Raji cells, Jurkat cells, MOLT-4 cells, pig thymus tissue, rabbit spleen tissue, Ramos cells, Daudi cells, Sp2/0 cells |
| Positive FC (Intra) detected in | Jurkat cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:5000-1:50000 |
| Flow Cytometry (FC) (INTRA) | FC (INTRA) : 0.4 ug per 10^6 cells in a 100 µl suspension |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
66966-1-Ig targets IKZF1 in WB, IF, FC (Intra), CoIP, ELISA applications and shows reactivity with human, mouse, pig, rabbit samples.
| Tested Reactivity | human, mouse, pig, rabbit |
| Cited Reactivity | human, mouse |
| Host / Isotype | Mouse / IgG1 |
| Class | Monoclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag28637 Product name: Recombinant human IKZF1 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 1-303 aa of BC018349 Sequence: MDADEGQDMSQVSGKESPPVSDTPDEGDEPMPIPEDLSTTSGGQQSSKSDRVVASNVKVETQSDEENGRACEMNGEECAEDLRMLDASGEKMNGSHRDQGSSALSGVGGIRLPNGKLKCDICGIICIGPNVLMVHKRSHTGERPFQCNQCGASFTQKGNLLRHIKLHSGEKPFKCHLCNYACRRRDALTGHLRTHSVIKEETNHSEMAEDLCKIGSERSLVLDRLASNVAKRKSSMPQKFLGDKGLSDTPYDSSASYEKENEMMKSHVMDQAINNAINYLGAESLRPLVQTPPGGSEVVPVIS Predict reactive species |
| Full Name | IKAROS family zinc finger 1 (Ikaros) |
| Calculated Molecular Weight | 477 aa, 53 kDa |
| Observed Molecular Weight | 55-65 kDa |
| GenBank Accession Number | BC018349 |
| Gene Symbol | IKZF1 |
| Gene ID (NCBI) | 10320 |
| RRID | AB_2882289 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein G purification |
| UNIPROT ID | Q13422 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
IKZF1, also known as DNA-binding protein Ikaros, Belongs to the Ikaros C2H2-type zinc-finger protein family. The N-terminal zinc-fingers 2 and 3 are required for DNA binding as well as for targeting IKFZ1 to pericentromeric heterochromatin. The C-terminal zinc-finger domain is required for dimerization. IKZF is abundantly expressed in thymus, spleen and peripheral blood Leukocytes and lymph nodes. IKZF1 is localized in nucleus. IKZF1 as a transcription regulator of hematopoietic cell differentiation binds gamma-satellite DNA and plays a role in the development of lymphocytes, B- and T-cells. Binds and activates the enhancer (delta-A element) of the CD3-delta gene. IKZF1 is a repressor of the TDT (fikzfterminal deoxynucleotidyltransferase) gene during thymocyte differentiation. IKZF1 exists some isofroms with MV 58KDa, 48KDa, 48KDa, 43KDa, 41KDa, 32KDa and 53KDa, respectively.
Protocols
| Product Specific Protocols | |
|---|---|
| FC protocol for IKZF1 antibody 66966-1-Ig | Download protocol |
| IHC protocol for IKZF1 antibody 66966-1-Ig | Download protocol |
| WB protocol for IKZF1 antibody 66966-1-Ig | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The anti-IKZF1 (Ikaros) antibody (Cat# 66966-1-Ig) has 5 total citations. These appear in Cancer Research, Nature Communications, Cell Communication and Signaling, International Journal of Molecular Sciences, and Journal of Medicinal Chemistry. Research fields span anticancer therapy, T-cell immunology, dendritic cell-mediated immunotherapy in IgA nephropathy, T-cell acute lymphoblastic leukemia transcriptional regulation, and hematologic malignancy drug discovery.
| Species | Application | Title |
|---|---|---|
Cancer Res Targeted Degradation of SOS1 Exhibits Potent Anticancer Activity and Overcomes Resistance in KRAS-Mutant Tumors and BCR-ABL-Positive Leukemia | ||
Nat Commun YTHDF2 upregulation and subcellular localization dictate CD8 T cell polyfunctionality in anti-tumor immunity | ||
Cell Commun Signal IKZF1 as a potential therapeutic target for dendritic cell-mediated immunotherapy in IgA nephropathy | ||
Int J Mol Sci Transcriptional Regulation of PIK3CD and PIKFYVE in T-Cell Acute Lymphoblastic Leukemia by IKAROS and Protein Kinase CK2. | ||
J Med Chem Discovery of BRD9 PROTAC/IMiD Bifunctional Molecules as Potent Therapeutics for Hematologic Malignancies. |













