IKZF1 Monoclonal antibody

• 

  WB analysis using 66966-1-Ig

  Various lysates were subjected to SDS PAGE followed by western blot with 66966-1-Ig (IKZF1 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of rabbit spleen using 66966-1-Ig

  rabbit spleen tissue were subjected to SDS PAGE followed by western blot with 66966-1-Ig (IKZF1 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of pig thymus using 66966-1-Ig

  pig thymus tissue were subjected to SDS PAGE followed by western blot with 66966-1-Ig (IKZF1 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.

• 

  WB analysis using 66966-1-Ig

  Various lysates were subjected to SDS PAGE followed by western blot with 66966-1-Ig (IKZF1 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of MOLT-4 using 66966-1-Ig

  WB result of IKZF1 antibody (66966-1-Ig; 1:8000; incubated at room temperature for 1.5 hours) with sh-Control and sh-IKZF1 transfected MOLT-4 cells.

• 

  IHC staining of human lymphoma using 66966-1-Ig

  Immunohistochemical analysis of paraffin-embedded human lymphoma tissue slide using 66966-1-Ig (IKZF1 antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• Featured Product
• KD/KO Validated

IKZF1 Monoclonal Antibody for WB, ELISA

Cat No. 66966-1-Ig

Clone No.1D6B5

Publications(4)

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse, pig, rabbit

Applications

WB, IF, CoIP, ELISA

Synonyms

DNA binding protein Ikaros, DNA-binding protein Ikaros, hIk 1, Hs.54452, IK1

---

Tested Applications

• Positive WB detected in: Raji cells, Jurkat cells, MOLT-4 cells, pig thymus tissue, rabbit spleen tissue, Ramos cells, Daudi cells, Sp2/0 cells

Recommended dilution

• Western Blot (WB): WB : 1:5000-1:50000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 2 publications below
• IF: See 1 publications below
• CoIP: See 1 publications below

Product Information

66966-1-Ig targets IKZF1 in WB, IF, CoIP, ELISA applications and shows reactivity with human, mouse, pig, rabbit samples.

• Tested Reactivity: human, mouse, pig, rabbit
• Cited Reactivity: human, mouse
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag28637

  Product name: Recombinant human IKZF1 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-303 aa of BC018349

  Sequence: MDADEGQDMSQVSGKESPPVSDTPDEGDEPMPIPEDLSTTSGGQQSSKSDRVVASNVKVETQSDEENGRACEMNGEECAEDLRMLDASGEKMNGSHRDQGSSALSGVGGIRLPNGKLKCDICGIICIGPNVLMVHKRSHTGERPFQCNQCGASFTQKGNLLRHIKLHSGEKPFKCHLCNYACRRRDALTGHLRTHSVIKEETNHSEMAEDLCKIGSERSLVLDRLASNVAKRKSSMPQKFLGDKGLSDTPYDSSASYEKENEMMKSHVMDQAINNAINYLGAESLRPLVQTPPGGSEVVPVIS

• Full Name: IKAROS family zinc finger 1 (Ikaros)
• Calculated Molecular Weight: 477 aa, 53 kDa
• Observed Molecular Weight: 55-65 kDa
• GenBank Accession Number: BC018349
• Gene Symbol: IKZF1
• Gene ID (NCBI): 10320
• RRID: AB_2882289
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: Q13422
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

IKZF1, also known as DNA-binding protein Ikaros, Belongs to the Ikaros C2H2-type zinc-finger protein family. The N-terminal zinc-fingers 2 and 3 are required for DNA binding as well as for targeting IKFZ1 to pericentromeric heterochromatin. The C-terminal zinc-finger domain is required for dimerization. IKZF is abundantly expressed in thymus, spleen and peripheral blood Leukocytes and lymph nodes. IKZF1 is localized in nucleus. IKZF1 as a transcription regulator of hematopoietic cell differentiation binds gamma-satellite DNA and plays a role in the development of lymphocytes, B- and T-cells. Binds and activates the enhancer (delta-A element) of the CD3-delta gene. IKZF1 is a repressor of the TDT (fikzfterminal deoxynucleotidyltransferase) gene during thymocyte differentiation. IKZF1 exists some isofroms with MV 58KDa, 48KDa, 48KDa, 43KDa, 41KDa, 32KDa and 53KDa, respectively.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	CoIP	Nat Commun; YTHDF2 upregulation and subcellular localization dictate CD8 T cell polyfunctionality in anti-tumor immunity; Authors - Haiyan Zhang
human	WB	Int J Mol Sci; Transcriptional Regulation of PIK3CD and PIKFYVE in T-Cell Acute Lymphoblastic Leukemia by IKAROS and Protein Kinase CK2.; Authors - Elanora Dovat
human	WB	Cancer Res; Targeted Degradation of SOS1 Exhibits Potent Anticancer Activity and Overcomes Resistance in KRAS-Mutant Tumors and BCR-ABL-Positive Leukemia; Authors - Ziwei Luo
mouse	IF	Cell Commun Signal; IKZF1 as a potential therapeutic target for dendritic cell-mediated immunotherapy in IgA nephropathy; Authors - Fei Peng