• Featured Product
  • KD/KO Validated

IKZF1 Monoclonal antibody

IKZF1 Monoclonal Antibody for WB, FC (Intra), ELISA
Cat No. 66966-1-Ig
Clone No.1D6B5

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse, pig, rabbit

Applications

WB, IF, FC (Intra), CoIP, ELISA

DNA binding protein Ikaros, DNA-binding protein Ikaros, hIk 1, Hs.54452, IK1

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Conjugate:  Unconjugated
Unconjugated
CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inRaji cells, Jurkat cells, MOLT-4 cells, pig thymus tissue, rabbit spleen tissue, Ramos cells, Daudi cells, Sp2/0 cells
Positive FC (Intra) detected inJurkat cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:5000-1:50000
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.4 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

66966-1-Ig targets IKZF1 in WB, IF, FC (Intra), CoIP, ELISA applications and shows reactivity with human, mouse, pig, rabbit samples.

Tested Reactivity human, mouse, pig, rabbit
Cited Reactivityhuman, mouse
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag28637

Product name: Recombinant human IKZF1 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 1-303 aa of BC018349

Sequence: MDADEGQDMSQVSGKESPPVSDTPDEGDEPMPIPEDLSTTSGGQQSSKSDRVVASNVKVETQSDEENGRACEMNGEECAEDLRMLDASGEKMNGSHRDQGSSALSGVGGIRLPNGKLKCDICGIICIGPNVLMVHKRSHTGERPFQCNQCGASFTQKGNLLRHIKLHSGEKPFKCHLCNYACRRRDALTGHLRTHSVIKEETNHSEMAEDLCKIGSERSLVLDRLASNVAKRKSSMPQKFLGDKGLSDTPYDSSASYEKENEMMKSHVMDQAINNAINYLGAESLRPLVQTPPGGSEVVPVIS

Predict reactive species
Full Name IKAROS family zinc finger 1 (Ikaros)
Calculated Molecular Weight 477 aa, 53 kDa
Observed Molecular Weight 55-65 kDa
GenBank Accession NumberBC018349
Gene Symbol IKZF1
Gene ID (NCBI) 10320
RRIDAB_2882289
Conjugate Unconjugated
FormLiquid
Purification MethodProtein G purification
UNIPROT IDQ13422
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

IKZF1, also known as DNA-binding protein Ikaros, Belongs to the Ikaros C2H2-type zinc-finger protein family. The N-terminal zinc-fingers 2 and 3 are required for DNA binding as well as for targeting IKFZ1 to pericentromeric heterochromatin. The C-terminal zinc-finger domain is required for dimerization. IKZF is abundantly expressed in thymus, spleen and peripheral blood Leukocytes and lymph nodes. IKZF1 is localized in nucleus. IKZF1 as a transcription regulator of hematopoietic cell differentiation binds gamma-satellite DNA and plays a role in the development of lymphocytes, B- and T-cells. Binds and activates the enhancer (delta-A element) of the CD3-delta gene. IKZF1 is a repressor of the TDT (fikzfterminal deoxynucleotidyltransferase) gene during thymocyte differentiation. IKZF1 exists some isofroms with MV 58KDa, 48KDa, 48KDa, 43KDa, 41KDa, 32KDa and 53KDa, respectively.

Protocols

Product Specific Protocols
FC protocol for IKZF1 antibody 66966-1-IgDownload protocol
IHC protocol for IKZF1 antibody 66966-1-IgDownload protocol
WB protocol for IKZF1 antibody 66966-1-IgDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
humanCoIP

Nat Commun

YTHDF2 upregulation and subcellular localization dictate CD8 T cell polyfunctionality in anti-tumor immunity

Authors - Haiyan Zhang
humanWB

Int J Mol Sci

Transcriptional Regulation of PIK3CD and PIKFYVE in T-Cell Acute Lymphoblastic Leukemia by IKAROS and Protein Kinase CK2.

Authors - Elanora Dovat
mouseIF

Cell Commun Signal

IKZF1 as a potential therapeutic target for dendritic cell-mediated immunotherapy in IgA nephropathy

Authors - Fei Peng
humanWB

Cancer Res

Targeted Degradation of SOS1 Exhibits Potent Anticancer Activity and Overcomes Resistance in KRAS-Mutant Tumors and BCR-ABL-Positive Leukemia

Authors - Ziwei Luo
Loading...
||
New chat Able
正在加载,请稍候...