IKZF1 Monoclonal antibody, PBS Only

• 

  WB analysis using 66966-1-Ig (same clone as 66966-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 66966-1-Ig (IKZF1 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 66966-1-PBS in a different storage buffer formulation.

• 

  WB analysis of rabbit spleen using 66966-1-Ig (same clone as 66966-1-PBS)

  rabbit spleen tissue were subjected to SDS PAGE followed by western blot with 66966-1-Ig (IKZF1 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 66966-1-PBS in a different storage buffer formulation.

• 

  WB analysis of pig thymus using 66966-1-Ig (same clone as 66966-1-PBS)

  pig thymus tissue were subjected to SDS PAGE followed by western blot with 66966-1-Ig (IKZF1 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 66966-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 66966-1-Ig (same clone as 66966-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 66966-1-Ig (IKZF1 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 66966-1-PBS in a different storage buffer formulation.

• 

  WB analysis of MOLT-4 using 66966-1-Ig (same clone as 66966-1-PBS)

  WB result of IKZF1 antibody (66966-1-Ig; 1:8000; incubated at room temperature for 1.5 hours) with sh-Control and sh-IKZF1 transfected MOLT-4 cells. This data was developed using the same antibody clone with 66966-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human lymphoma using 66966-1-Ig (same clone as 66966-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human lymphoma tissue slide using 66966-1-Ig (IKZF1 antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 66966-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

IKZF1 Monoclonal Antibody for WB, Indirect ELISA

Cat No. 66966-1-PBS

Clone No.1D6B5

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse, pig, rabbit

Applications

WB, Indirect ELISA

Synonyms

DNA binding protein Ikaros, DNA-binding protein Ikaros, hIk 1, Hs.54452, IK1

---

Product Information

66966-1-PBS targets IKZF1 in WB, Indirect ELISA applications and shows reactivity with human, mouse, pig, rabbit samples.

• Tested Reactivity: human, mouse, pig, rabbit
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag28637

  Product name: Recombinant human IKZF1 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-303 aa of BC018349

  Sequence: MDADEGQDMSQVSGKESPPVSDTPDEGDEPMPIPEDLSTTSGGQQSSKSDRVVASNVKVETQSDEENGRACEMNGEECAEDLRMLDASGEKMNGSHRDQGSSALSGVGGIRLPNGKLKCDICGIICIGPNVLMVHKRSHTGERPFQCNQCGASFTQKGNLLRHIKLHSGEKPFKCHLCNYACRRRDALTGHLRTHSVIKEETNHSEMAEDLCKIGSERSLVLDRLASNVAKRKSSMPQKFLGDKGLSDTPYDSSASYEKENEMMKSHVMDQAINNAINYLGAESLRPLVQTPPGGSEVVPVIS

• Full Name: IKAROS family zinc finger 1 (Ikaros)
• Calculated Molecular Weight: 477 aa, 53 kDa
• Observed Molecular Weight: 55-65 kDa
• GenBank Accession Number: BC018349
• Gene Symbol: IKZF1
• Gene ID (NCBI): 10320
• RRID: AB_2882289
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: Q13422
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

IKZF1, also known as DNA-binding protein Ikaros, Belongs to the Ikaros C2H2-type zinc-finger protein family. The N-terminal zinc-fingers 2 and 3 are required for DNA binding as well as for targeting IKFZ1 to pericentromeric heterochromatin. The C-terminal zinc-finger domain is required for dimerization. IKZF is abundantly expressed in thymus, spleen and peripheral blood Leukocytes and lymph nodes. IKZF1 is localized in nucleus. IKZF1 as a transcription regulator of hematopoietic cell differentiation binds gamma-satellite DNA and plays a role in the development of lymphocytes, B- and T-cells. Binds and activates the enhancer (delta-A element) of the CD3-delta gene. IKZF1 is a repressor of the TDT (fikzfterminal deoxynucleotidyltransferase) gene during thymocyte differentiation. IKZF1 exists some isofroms with MV 58KDa, 48KDa, 48KDa, 43KDa, 41KDa, 32KDa and 53KDa, respectively.