• Featured Product
  • KD/KO Validated

CoraLite® Plus 488-conjugated IFT20 Polyclonal antibody

IFT20 Polyclonal Antibody for IF/ICC
Cat No. CL488-13615

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, Canine

Applications

IF/ICC

hIFT20, IFT20

Formulation:  PBS, Proclin 300, BSA, Glycerol
PBS, Proclin 300, BSA, Glycerol
Conjugate:  CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IF/ICC detected inhTERT-RPE1 cells

Recommended dilution

ApplicationDilution
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL488-13615 targets IFT20 in IF/ICC applications and shows reactivity with human, mouse, Canine samples.

Tested Reactivity human, mouse, Canine
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag4521

Product name: Recombinant human IFT20 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-132 aa of BC038094

Sequence: MAKDILGEAGLHFDELNKLRVLDPEVTQQTIELKEECKDFVDKIGQFQKIVGGLIELVDQLAKEAENEKMKAIGARNLLKSIAKQREAQQQQLQALIAEKKMQLERYRVEYEALCKVEAEQNEFIDQFIFQK

Predict reactive species
Full Name intraflagellar transport 20 homolog (Chlamydomonas)
Calculated Molecular Weight 15 kDa
Observed Molecular Weight 15-18 kDa
GenBank Accession NumberBC038094
Gene Symbol IFT20
Gene ID (NCBI) 90410
RRIDAB_3672570
Conjugate CoraLite® Plus 488 Fluorescent Dye
Excitation/Emission Maxima Wavelengths493 nm / 522 nm
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ8IY31
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

Intraflagellar transport (IFT), mediated by molecular motors and IFT particles, is an important transport process that occurs in the cilium. IFT particles are multi-subunit complexes that are made up of complex A and complex B. IFT20 is a component of IFT complex B and involved in ciliary process assembly. It is associated with the Golgi complex and plays a role in the trafficking of ciliary membrane proteins from the Golgi complex to the cilium.

Protocols

Product Specific Protocols
IF protocol for CL Plus 488 IFT20 antibody CL488-13615Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...