IFT20 Polyclonal antibody

• 

  WB analysis of HEK-293 using 13615-1-AP

  WB result of IFT20 antibody (13615-1-AP, 1:500) with si-Control and si-IFT20 transfected HEK293 cells.

• 

  WB analysis using 13615-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 13615-1-AP (IFT20 antibody) at dilution of 1:800 incubated at room temperature for 1.5 hours.

• 

  WB analysis of MDCK using 13615-1-AP

  MDCK cells were subjected to SDS PAGE followed by western blot with 13615-1-AP (IFT20 antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HEK-293 using 13615-1-AP

  HEK-293 cells were subjected to SDS PAGE followed by western blot with 13615-1-AP (IFT20 Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

• 

  IP experiment of mouse testis using 13615-1-AP

  IP result of anti-IFT20 (IP:13615-1-AP, 3ug; Detection:13615-1-AP 1:700) with mouse testis tissue lysate 4000ug.

• 

  IHC staining of human endometrial cancer using 13615-1-AP

  Immunohistochemical analysis of paraffin-embedded human endometrial cancer tissue slide using 13615-1-AP (IFT20 Antibody) at dilution of 1:50 (under 10x lens).

• 

  IHC staining of human endometrial cancer using 13615-1-AP

  Immunohistochemical analysis of paraffin-embedded human endometrial cancer tissue slide using 13615-1-AP (IFT20 Antibody) at dilution of 1:50 (under 40x lens).

• 

  IHC staining of mouse brain using 13615-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 13615-1-AP (IFT20 antibody) at dilution of 1:500 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse brain using 13615-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 13615-1-AP (IFT20 antibody) at dilution of 1:500 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of hTERT-RPE1 cells using 13615-1-AP

  IF result (localization to Golgi-like structures) of anti-IFT20 (13615-1-AP, 1:50) with serum-starved hTERT-RPE1 (MoTH fixed) by Dr. Moshe Kim.

• 

  IF Staining of hTERT-RPE1 using 13615-1-AP

  Immunofluorescent analysis of (-20°C Methanol) fixed hTERT-RPE1 cells using IFT20 antibody (13615-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L), CoraLite®594 ARL13B antibody (CL594-17711, red).

• 

  IF Staining of MDCK using 13615-1-AP

  Immunofluorescent analysis of (10% Formaldehyde) fixed MDCK cells using 13615-1-AP (IFT20 antibody) at dilution of 1:100 and Alexa Fluor 488-conjugated AffiniPure Goat Anti-Rabbit IgG(H+L).

• Featured Product
• KD/KO Validated

IFT20 Polyclonal Antibody for WB, IHC, IF/ICC, IP, ELISA

Cat No. 13615-1-AP

Publications(82)

Reviews (4)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat, canine and More (1)

Applications

WB, IHC, IF/ICC, IP, CoIP, ELISA

Synonyms

hIFT20, Intraflagellar transport protein 20 homolog

---

Tested Applications

• Positive WB detected in: HEK-293 cells, MDCK cells, mouse testis tissue, rat testis tissue
• Positive IP detected in: mouse testis tissue
• Positive IHC detected in: mouse brain tissue, human endometrial cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: hTERT-RPE1 cells, MDCK cells

Recommended dilution

• Western Blot (WB): WB : 1:300-1:800
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunohistochemistry (IHC): IHC : 1:50-1:500
• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• KD/KO: See 16 publications below
• WB: See 47 publications below
• IHC: See 6 publications below
• IF: See 49 publications below
• IP: See 2 publications below
• CoIP: See 1 publications below

Product Information

13615-1-AP targets IFT20 in WB, IHC, IF/ICC, IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat, canine samples.

• Tested Reactivity: human, mouse, rat, canine
• Cited Reactivity: human, mouse, rat, canine, zebrafish
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag4521

  Product name: Recombinant human IFT20 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-132 aa of BC038094

  Sequence: MAKDILGEAGLHFDELNKLRVLDPEVTQQTIELKEECKDFVDKIGQFQKIVGGLIELVDQLAKEAENEKMKAIGARNLLKSIAKQREAQQQQLQALIAEKKMQLERYRVEYEALCKVEAEQNEFIDQFIFQK

• Full Name: intraflagellar transport 20 homolog (Chlamydomonas)
• Calculated Molecular Weight: 15 kDa
• Observed Molecular Weight: 15-18 kDa
• GenBank Accession Number: BC038094
• Gene Symbol: IFT20
• Gene ID (NCBI): 90410
• RRID: AB_2280001
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q8IY31
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Intraflagellar transport (IFT), mediated by molecular motors and IFT particles, is an important transport process that occurs in the cilium. IFT particles are multi-subunit complexes that are made up of complex A and complex B. IFT20 is a component of IFT complex B and involved in ciliary process assembly. It is associated with the Golgi complex and plays a role in the trafficking of ciliary membrane proteins from the Golgi complex to the cilium.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	WB	Nature; Functional interaction between autophagy and ciliogenesis.; Authors - Pampliega Olatz O
mouse	IF	Nat Cell Biol; Early steps in primary cilium assembly require EHD1/EHD3-dependent ciliary vesicle formation.; Authors - Quanlong Lu
human	IF	Nat Cell Biol; Early steps in primary cilium assembly require EHD1/EHD3-dependent ciliary vesicle formation.; Authors - Quanlong Lu
human	WB	Sci Adv; An EMT-primary cilium-GLIS2 signaling axis regulates mammogenesis and claudin-low breast tumorigenesis.; Authors - Molly M Wilson
human	IF	Nat Commun; Microtubule asters anchored by FSD1 control axoneme assembly and ciliogenesis.; Authors - Hai-Qing Tu
human	WB	Proc Natl Acad Sci U S A; EMT programs promote basal mammary stem cell and tumor-initiating cell stemness by inducing primary ciliogenesis and Hedgehog signaling.; Authors - Vincent J Guen ; KO Validated

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.

---

FH

Lola (Verified Customer) (10-23-2025)

This antibody shows good specificity and low background. Suitable for immunofluorescence and expansion microscopy. It works with PFA and cold MeOH fixation.

• Applications: Immunofluorescence
• Primary Antibody Dilution: 1:250
• Cell Tissue Type: Primary myoblasts

IFT20 Antibody Immunofluorescence validation (1:250 dilution) in Primary myoblasts (Cat no:13615-1-AP)

FH

Charlotte (Verified Customer) (07-18-2024)

I did the standard iF protocol on the classic LIGHT2 cells used to study Hh signalling that depends on the primary cilia: PFA 4% 10 min cold methanol 5 min 1h in 1% BSA in PBST 1/150 in blocking solution, O.N. at 4°C 5*5min PBST 1/500 in blocking solution, 1h at RT° 4*5min PBST + 5min PBS I'm not convinced as the background is super dotty and quite important. Maybe the conditions must be optimized but it doesn't look promising

• Applications: Immunofluorescence
• Primary Antibody Dilution: 1/150
• Cell Tissue Type: LIGHT2

IFT20 Antibody Immunofluorescence validation (1/150 dilution) in LIGHT2 (Cat no:13615-1-AP)

FH

kes (Verified Customer) (01-17-2022)

I used it for WB(1:1000) and IF for cilia (1:200) and got good results.

• Applications: Western Blot, Immunofluorescence
• Primary Antibody Dilution: 1:1000
• Cell Tissue Type: Human Liver cells

FH

Boyan (Verified Customer) (03-15-2019)

Excellent for IF labelling of the Golgi under PFA fixation.

• Applications: Immunofluorescence,
• Cell Tissue Type: MEF