Filter: AllWBIHCFC (Intra)Cytometric bead array sample testCytometric bead array

WB analysis using 66770-1-Ig (same clone as 66770-1-PBS)
Various lysates were subjected to SDS PAGE followed by western blot with 66770-1-Ig (IFIH1 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 66770-1-PBS in a different storage buffer formulation.
WB analysis using 66770-1-Ig (same clone as 66770-1-PBS)
Various lysates were subjected to SDS PAGE followed by western blot with 66770-1-Ig (IFIH1/MDA5 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. The membrane was stripped and reblotted with HRP-conjugated Alpha Tubulin Monoclonal antibody (HRP-66031) as loading control. This data was developed using the same antibody clone with 66770-1-PBS in a different storage buffer formulation.
×
Various lysates were subjected to SDS PAGE followed by western blot with 66770-1-Ig (IFIH1/MDA5 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. The membrane was stripped and reblotted with HRP-conjugated Alpha Tubulin Monoclonal antibody (HRP-66031) as loading control. This data was developed using the same antibody clone with 66770-1-PBS in a different storage buffer formulation.
WB analysis using 66770-1-Ig (same clone as 66770-1-PBS)
Various lysates were subjected to SDS PAGE followed by western blot with 66770-1-Ig (IFIH1 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 66770-1-PBS in a different storage buffer formulation.
IHC staining of human liver cancer using 66770-1-Ig (same clone as 66770-1-PBS)
Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 66770-1-Ig (IFIH1/MDA5 antibody) at dilution of 1:500 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 66770-1-PBS in a different storage buffer formulation.
IHC staining of human liver cancer using 66770-1-Ig (same clone as 66770-1-PBS)
Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 66770-1-Ig (IFIH1/MDA5 antibody) at dilution of 1:500 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 66770-1-PBS in a different storage buffer formulation.
IHC staining of human kidney using 66770-1-Ig (same clone as 66770-1-PBS)
Immunohistochemical analysis of paraffin-embedded human kidney tissue slide using 66770-1-Ig (IFIH1/MDA5 antibody) at dilution of 1:500 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 66770-1-PBS in a different storage buffer formulation.
IHC staining of human kidney using 66770-1-Ig (same clone as 66770-1-PBS)
Immunohistochemical analysis of paraffin-embedded human kidney tissue slide using 66770-1-Ig (IFIH1/MDA5 antibody) at dilution of 1:500 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 66770-1-PBS in a different storage buffer formulation.
FC experiment of Jurkat using 66770-1-Ig (same clone as 66770-1-PBS)
1x10^6 Jurkat cells were intracellularly stained with 0.25 ug IFIH1/MDA5 Monoclonal antibody (66770-1-Ig, Clone:3D8B11) and CoraLite®488-Conjugated Goat Anti-Mouse IgG(H+L) (SA00013-1)(red), or 0.25 ug Mouse IgG1 isotype control Mouse McAb (66360-1-Ig, Clone: 1F8D3) (blue). Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer. This data was developed using the same antibody clone with 66770-1-PBS in a different storage buffer formulation.
×
1x10^6 Jurkat cells were intracellularly stained with 0.25 ug IFIH1/MDA5 Monoclonal antibody (66770-1-Ig, Clone:3D8B11) and CoraLite®488-Conjugated Goat Anti-Mouse IgG(H+L) (SA00013-1)(red), or 0.25 ug Mouse IgG1 isotype control Mouse McAb (66360-1-Ig, Clone: 1F8D3) (blue). Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer. This data was developed using the same antibody clone with 66770-1-PBS in a different storage buffer formulation.
Cytometric bead array sample test of MP51583-1
Cytometric bead array sample test of MP51583-1, IFIH1 Monoclonal Matched Antibody Pair, PBS Only. Capture antibody: 66770-1-PBS. Detection antibody: 66770-2-PBS.
Cytometric bead array standard curve of MP51583-1
Cytometric bead array standard curve of MP51583-1, IFIH1 Monoclonal Matched Antibody Pair, PBS Only. Capture antibody: 66770-1-PBS. Detection antibody: 66770-2-PBS. Standard:Ag17448. Range: 0.391-50 ng/mL.

Featured Product
KD/KO Validated

IFIH1/MDA5 Monoclonal antibody, PBS Only (Capture)

Name: IFIH1/MDA5 Monoclonal antibody, PBS Only (Capture)
Brand: Proteintech
SKU: 66770-1-PBS

IFIH1/MDA5 Monoclonal Antibody for WB, IHC, FC (Intra), Cytometric bead array, Indirect ELISA

Cat No. 66770-1-PBS

Clone No.3D8B11

Review Product

Host / Isotype

Mouse / IgG1

Reactivity

human

Applications

WB, IHC, FC (Intra), Cytometric bead array, Indirect ELISA

Synonyms

IFIH1, MDA5, 3D8B11, CADM-140 autoantigen, Clinically amyopathic dermatomyositis autoantigen 140 kDa

Formulation: PBS Only

PBS, Azide, Glycerol

PBS Only

Conjugate: Unconjugated

Size/Concentration:

-/ -

Freight/Packing: -

Quantity

- +

Request bulk or custom quote

Proteintech Guarantee

Overview

Tested Applications
Product Information

Print datasheet

MSDS SDS

Product Information

66770-1-PBS targets IFIH1/MDA5 as part of a matched antibody pair:

MP51583-1: 66770-1-PBS capture and 66770-2-PBS detection (validated in Cytometric bead array)

Unconjugated mouse monoclonal antibody pair in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

Tested Reactivity	human
Host / Isotype	Mouse / IgG1
Class	Monoclonal
Type	Antibody
Immunogen	CatNo: Ag17448 Product name: Recombinant human IFIH1 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 1-310 aa of BC111750 Sequence: MSNGYSTDENFRYLISCFRARVKMYIQVEPVLDYLTFLPAEVKEQIQRTVATSGNMQAVELLLSTLEKGVWHLGWTREFVEALRRTGSPLAARYMNPELTDLPSPSFENAHDEYLQLLNLLQPTLVDKLLVRDVLDKCMEEELLTIEDRNRIAAAENNGNESGVRELLKRIVQKENWFSAFLNVLRQTGNNELVQELTGSDCSESNAEIENLSQVDGPQVEEQLLSTTVQPNLEKEVWGMENNSSESSFADSSVVSESDTSLAEGSVSCLDESLGHNSNMGSDSGTMGSDSDEENVAARASPEPELQLRP Predict reactive species
Full Name	interferon induced with helicase C domain 1
Calculated Molecular Weight	1025 aa, 117 kDa
Observed Molecular Weight	117-125 kDa
GenBank Accession Number	BC111750
Gene Symbol	IFIH1
Gene ID (NCBI)	64135
RRID	AB_2882116
Conjugate	Unconjugated
Form	Liquid
Purification Method	Protein G purification
UNIPROT ID	Q9BYX4
Storage Buffer	PBS only, pH 7.3.
Storage Conditions	Store at -80°C.

Background Information

IFIH1 (Interferon-induced helicase C domain-containing protein 1) is a putative RNA helicase that is upregulated in response to treatment with IFNB or IFNB and MEZ. It is also named as MDA5 and RH116. Ectopic expression of MDA5 in melanoma cells resulted in reduced colony formation, suggesting an interaction of the CARD and apoptotic signal molecules. Functional analysis indicated that MDA5 is an RNA-dependent ATPase. IFIH1 has an apparent molecular mass of 117-130 kDa, and always other bands (70 kDa and 90 kDa) can be detected as cleaved products (PMID: 17267501).