Use Able AI chat for product recommendations
  • Featured Product
  • KD/KO Validated

HSP27 Polyclonal antibody

HSP27 Polyclonal Antibody for WB, IHC, IF/ICC, FC (Intra), IP, ELISA

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat and More (4)

Applications

WB, IHC, IF/ICC, FC (Intra), IP, CoIP, ELISA

HSPB1, CMT2F, Estrogen-regulated 24 kDa protein, HMN2B, Hsp25

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 
SKU: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:

Able AI
Able AI
What's the best dilution for HSP27 in ?

Tested Applications

Positive WB detected inA549 cells, HeLa cells, C6 cells, mouse liver tissue, HepG2 cells, U2OS cells
Positive IP detected inA549 cells
Positive IHC detected inhuman lung cancer tissue, human liver cancer tissue, human gliomas tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF/ICC detected inHeLa cells, MCF-7 cells
Positive FC (Intra) detected inMCF-7 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:5000-1:50000
Immunoprecipitation (IP)IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
Immunohistochemistry (IHC)IHC : 1:50-1:500
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.50 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

18284-1-AP targets HSP27 in WB, IHC, IF/ICC, FC (Intra), IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Cited Reactivityhuman, mouse, rat, pig, chicken, hamster, fish
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag13161

Product name: Recombinant human HSPB1 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-205 aa of BC012768

Sequence: MTERRVPFSLLRGPSWDPFRDWYPHSRLFDQAFGLPRLPEEWSQWLGGSSWPGYVRPLPPAAIESPAVAAPAYSRALSRQLSSGVSEIRHTADRWRVSLDVNHFAPDELTVKTKDGVVEITGKHEERQDEHGYISRCFTRKYTLPPGVDPTQVSSSLSPEGTLTVEAPMPKLATQSNEITIPVTFESRAQLGGPEAAKSDETAAK

Predict reactive species
Full Name heat shock 27kDa protein 1
Calculated Molecular Weight 19-23 kDa
Observed Molecular Weight 27 kDa
GenBank Accession NumberBC012768
Gene Symbol HSPB1
Gene ID (NCBI) 3315
RRIDAB_2295540
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDP04792
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

HSPB1, also known as heat shock protein 27 (HSP27), belongs to the small heat shock protein family which is induced in response to environmental challenges or/and developmental transitions. It is also an anti-apoptotic protein that plays crucial roles in tumorigenesis and cell survival and is reported to be an independent prognosis marker for cancer. Recently HSPB1 has been found to be a valuable marker for melanoma. In addition to the predicted 27 kDa, an extra 50-55 kDa representing dimeric form of HSPB1 may also be observed (PMID: 21353161). It's notable that mouse HSP27 is also named HSP25 and has the predicted MW between 19-23 kDa.

Protocols

Product Specific Protocols
FC protocol for HSP27 antibody 18284-1-APDownload protocol
IF protocol for HSP27 antibody 18284-1-APDownload protocol
IHC protocol for HSP27 antibody 18284-1-APDownload protocol
IP protocol for HSP27 antibody 18284-1-APDownload protocol
WB protocol for HSP27 antibody 18284-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

What published studies show

The HSP27 Polyclonal antibody (Cat# 18284-1-AP) has 65 total citations published in high-impact journals including Nature, Science, Cell, Blood, Nature Cell Biology, Science Advances, Cancer Letters, Small, and Autophagy, among others. Associated research fields include ferroptosis, oncology (glioma, hepatocellular carcinoma, melanoma, pancreatic cancer), neurodegeneration (Alzheimer's disease), inflammatory diseases, viral infections, autophagy, oxidative stress, fibrosis, and proteomics. Primary applications are Western blotting, IHC, IF, IP, CoIP, and ELISA.

SpeciesApplicationTitle
humanWB

Nature

Oxidative cyclization reagents reveal tryptophan cation-π interactions

Authors - Xiao Xie
humanWB

Science

Molecular and cellular processes disrupted in the early postnatal Down syndrome prefrontal cortex.

Authors - Ryan D Risgaard
humanWB

Cell

Human hematopoietic stem cell vulnerability to ferroptosis

Authors - Jiawei Zhao
humanWB

Blood

Targeting STK17B kinase activates ferroptosis and suppresses drug resistance in multiple myeloma.

Authors - Zhibo Yan
  • KD Validated
IF

Nat Cell Biol

Proteostasis and lysosomal repair deficits in transdifferentiated neurons of Alzheimer's disease

Authors - Ching-Chieh Chou

Autophagy

ATG4B/autophagin-1 regulates intestinal homeostasis and protects mice from experimental colitis.

Authors - Cabrera Sandra S

Reviews

    5.0 out of 5
Add a review

1 verified customer reviews

What customers say

One reviewer (Tom Ryan, 2020) gave a 5-star rating after using this antibody for Western Blot on HEK293T lysate at a 1:1000 dilution. The protocol used a 4–20% gradient gel, 5% BSA blocking for 1 hour, overnight incubation at 4°C, and goat anti-rabbit HRP secondary at 1:10,000 for 1 hour. The reviewer included an image showing clear HSP27 band detection. Overall, the single review reflects a positive experience with reliable WB performance.

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


Tom (Verified Customer) (09-28-2020)

HEK293T lysate (10ug) ran on 4-20% gradient gel. Blocking in 5% BSA for 1 hour, followed by HSP27 (1:1000 in block) overnight at 4 degrees. Goat anti-rabbit HRP (1:10,000) for 1 hour in block.

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:1000
  • Cell Tissue Type: HEK293
HSP27 Antibody Western Blot validation (1:1000 dilution) in HEK293 (Cat no:18284-1-AP)
Loading...
||
New chat

Able™

正在加载,请稍候...