Tested Applications
| Positive WB detected in | A549 cells, HeLa cells, C6 cells, mouse liver tissue, HepG2 cells, U2OS cells |
| Positive IP detected in | A549 cells |
| Positive IHC detected in | human lung cancer tissue, human liver cancer tissue, human gliomas tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | HeLa cells, MCF-7 cells |
| Positive FC (Intra) detected in | MCF-7 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:5000-1:50000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
| Flow Cytometry (FC) (INTRA) | FC (INTRA) : 0.50 ug per 10^6 cells in a 100 µl suspension |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
18284-1-AP targets HSP27 in WB, IHC, IF/ICC, FC (Intra), IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse, rat, pig, chicken, hamster, fish |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag13161 Product name: Recombinant human HSPB1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-205 aa of BC012768 Sequence: MTERRVPFSLLRGPSWDPFRDWYPHSRLFDQAFGLPRLPEEWSQWLGGSSWPGYVRPLPPAAIESPAVAAPAYSRALSRQLSSGVSEIRHTADRWRVSLDVNHFAPDELTVKTKDGVVEITGKHEERQDEHGYISRCFTRKYTLPPGVDPTQVSSSLSPEGTLTVEAPMPKLATQSNEITIPVTFESRAQLGGPEAAKSDETAAK Predict reactive species |
| Full Name | heat shock 27kDa protein 1 |
| Calculated Molecular Weight | 19-23 kDa |
| Observed Molecular Weight | 27 kDa |
| GenBank Accession Number | BC012768 |
| Gene Symbol | HSPB1 |
| Gene ID (NCBI) | 3315 |
| RRID | AB_2295540 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P04792 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
HSPB1, also known as heat shock protein 27 (HSP27), belongs to the small heat shock protein family which is induced in response to environmental challenges or/and developmental transitions. It is also an anti-apoptotic protein that plays crucial roles in tumorigenesis and cell survival and is reported to be an independent prognosis marker for cancer. Recently HSPB1 has been found to be a valuable marker for melanoma. In addition to the predicted 27 kDa, an extra 50-55 kDa representing dimeric form of HSPB1 may also be observed (PMID: 21353161). It's notable that mouse HSP27 is also named HSP25 and has the predicted MW between 19-23 kDa.
Protocols
| Product Specific Protocols | |
|---|---|
| FC protocol for HSP27 antibody 18284-1-AP | Download protocol |
| IF protocol for HSP27 antibody 18284-1-AP | Download protocol |
| IHC protocol for HSP27 antibody 18284-1-AP | Download protocol |
| IP protocol for HSP27 antibody 18284-1-AP | Download protocol |
| WB protocol for HSP27 antibody 18284-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The HSP27 Polyclonal antibody (Cat# 18284-1-AP) has 65 total citations published in high-impact journals including Nature, Science, Cell, Blood, Nature Cell Biology, Science Advances, Cancer Letters, Small, and Autophagy, among others. Associated research fields include ferroptosis, oncology (glioma, hepatocellular carcinoma, melanoma, pancreatic cancer), neurodegeneration (Alzheimer's disease), inflammatory diseases, viral infections, autophagy, oxidative stress, fibrosis, and proteomics. Primary applications are Western blotting, IHC, IF, IP, CoIP, and ELISA.
| Species | Application | Title |
|---|---|---|
Science Molecular and cellular processes disrupted in the early postnatal Down syndrome prefrontal cortex. | ||
Blood Targeting STK17B kinase activates ferroptosis and suppresses drug resistance in multiple myeloma.
| ||
Nat Cell Biol Proteostasis and lysosomal repair deficits in transdifferentiated neurons of Alzheimer's disease | ||
Autophagy ATG4B/autophagin-1 regulates intestinal homeostasis and protects mice from experimental colitis. |
Reviews
What customers say
One reviewer (Tom Ryan, 2020) gave a 5-star rating after using this antibody for Western Blot on HEK293T lysate at a 1:1000 dilution. The protocol used a 4–20% gradient gel, 5% BSA blocking for 1 hour, overnight incubation at 4°C, and goat anti-rabbit HRP secondary at 1:10,000 for 1 hour. The reviewer included an image showing clear HSP27 band detection. Overall, the single review reflects a positive experience with reliable WB performance.
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
Tom (Verified Customer) (09-28-2020) | HEK293T lysate (10ug) ran on 4-20% gradient gel. Blocking in 5% BSA for 1 hour, followed by HSP27 (1:1000 in block) overnight at 4 degrees. Goat anti-rabbit HRP (1:10,000) for 1 hour in block.
 |
