HMGB2 Recombinant monoclonal antibody, PBS Only

• 

  WB analysis using 83482-4-RR (same clone as 83482-4-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 83482-4-RR (HMGB2 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 83482-4-PBS in a different storage buffer formulation.

• 

  FC experiment of HeLa using 83482-4-RR (same clone as 83482-4-PBS)

  1x10^6 HeLa cells were intracellularly stained with 0.25 ug HMGB2 Recombinant antibody (83482-4-RR, Clone:240453C11) and APC-Conjugated Goat Anti-Rabbit IgG(H+L)(red), or 0.25 ug Isotype Control (blue). Cells were fixed and permeabilized with Transcription Factor Staining Buffer Kit (PF00011). This data was developed using the same antibody clone with 83482-4-PBS in a different storage buffer formulation.

• 

  Affinity and Kinetic Characterization of 83482-4-RR

  Biolayer interferometry (BLl) kinetic assays of 83482-4-RR against Human HMGB2 were performed. The affinity constant is 16.4 nM.

HMGB2 Uni-rAb^® Recombinant Antibody for WB, ELISA

Cat No. 83482-4-PBS

Clone No.240453C11

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, ELISA

Synonyms

HMG2, HMG 2, High mobility group protein B2, High mobility group protein 2, high mobility group box 2

---

Product Information

83482-4-PBS targets HMGB2 in WB, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag6135

  Product name: Recombinant human HMGB2 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 44-207 aa of BC001063

  Sequence: KCSERWKTMSAKEKSKFEDMAKSDKARYDREMKNYVPPKGDKKGKKKDPNAPKRPPSAFFLFCSEHRPKIKSEHPGLSIGDTAKKLGEMWSEQSAKDKQPYEQKAAKLKEKYEKDIAAYRAKGKSEAGKKGPGRPTGSKKKNEPEDEEEEEEEEDEDEEEEDED

• Full Name: high-mobility group box 2
• Calculated Molecular Weight: 24 kDa
• GenBank Accession Number: BC001063
• Gene Symbol: HMGB2
• Gene ID (NCBI): 3148
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purfication
• UNIPROT ID: P26583
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.