• Featured Product
  • KD/KO Validated

Glutamine Synthetase Monoclonal antibody, PBS Only (Detector)

Glutamine Synthetase Monoclonal Antibody for WB, IHC, IF, Cytometric bead array, Indirect ELISA
Cat No. 66323-1-PBS
Clone No.1D10G8

Host / Isotype

Mouse / IgG2b

Reactivity

human, pig, zebrafish

Applications

WB, IHC, IF, Cytometric bead array, Indirect ELISA

GLUL, Glutamate--ammonia ligase, GLNS, EC:6.3.1.2, EC:2.3.1.225

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

66323-1-PBS targets Glutamine Synthetase as part of a matched antibody pair:

MP50483-1: 66323-2-PBS capture and 66323-1-PBS detection (validated in Cytometric bead array)

Unconjugated mouse monoclonal antibody pair in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

Tested Reactivity human, pig, zebrafish
Host / Isotype Mouse / IgG2b
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag6309

Product name: Recombinant human Glutamine synthetase protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 1-373 aa of BC011700

Sequence: MTTSASSHLNKGIKQVYMSLPQGEKVQAMYIWIDGTGEGLRCKTRTLDSEPKCVEELPEWNFDGSSTLQSEGSNSDMYLVPAAMFRDPFRKDPNKLVLCEVFKYNRRPAETNLRHTCKRIMDMVSNQHPWFGMEQEYTLMGTDGHPFGWPSNGFPGPQGPYYCGVGADRAYGRDIVEAHYRACLYAGVKIAGTNAEVMPAQWEFQIGPCEGISMGDHLWVARFILHRVCEDFGVIATFDPKPIPGNWNGAGCHTNFSTKAMREENGLKYIEEAIEKLSKRHQYHIRAYDPKGGLDNARRLTGFHETSNINDFSAGVANRSASIRIPRTVGQEKKGYFEDRRPSANCDPFSVTEALIRTCLLNETGDEPFQYKN

Predict reactive species
Full Name glutamate-ammonia ligase (glutamine synthetase)
Calculated Molecular Weight 374 aa, 42 kDa
Observed Molecular Weight 42 kDa
GenBank Accession NumberBC011700
Gene Symbol Glutamine Synthetase
Gene ID (NCBI) 2752
RRIDAB_2881703
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP15104
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

GLUL(Glutamine synthetase) is also named as GS,GLNS and belongs to the glutamine synthetase family.This enzyme has 2 functions: it catalyzes the production of glutamine and 4-aminobutanoate (gamma-aminobutyric acid, GABA), the latter in a pyridoxal phosphate-independent manner By similarity. Essential for proliferation of fetal skin fibroblasts (PMID:18662667).Defects in GLUL are the cause of congenital systemic glutamine deficiency (CSGD).Organismal glutamine production is augmented secondary to an increase in the activity of glutamine synthetase in the lung and skeletal muscle(PMID:7630137). There are other bands with higher (66 kDa, 97 kDa) and lower (30 kDa)molecular weights also detected besides the 42 kDa band indicating the proteolysis of GLUL protein by the ubiquitin system(PMID:10091759).

Loading...
||
New chat

Able

正在加载,请稍候...