Tested Applications
| Positive WB detected in | HeLa cells, HEK-293 cells, HepG2 cells, Jurkat cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:2000-1:15000 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| WB | See 3 publications below |
Product Information
82822-2-RR targets GPX4 (Human Specific) in WB, ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Cited Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Recombinant |
| Type | Antibody |
| Immunogen |
CatNo: Ag30650 Product name: Recombinant human GPX4 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 107-197 aa of BC021567 Sequence: KQEPGSNEEIKEFAAGYNVKFDMFSKICVNGDDAHPLWKWMKIQPKGKGILGNAIKWNFTKFLIDKNGCVVKRYGPMEEPLVIEKDLPHYF Predict reactive species |
| Full Name | glutathione peroxidase 4 (phospholipid hydroperoxidase) |
| Observed Molecular Weight | 20-23 kDa |
| GenBank Accession Number | BC021567 |
| Gene Symbol | GPX4 |
| Gene ID (NCBI) | 2879 |
| RRID | AB_3086547 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein A purification |
| UNIPROT ID | P36969 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
GPX4 (Phospholipid hydroperoxide glutathione peroxidase, mitochondrial) protects cells against membrane lipid peroxidation and cell death. Required for normal sperm development and male fertility.It has two isforms about 20KDa and 22KDa, respectively. GPX4 is a monomer,but it has a tendency to form higher mass oligomers (PMID:17630701).82822-2-RR is human specific.
Protocols
| Product Specific Protocols | |
|---|---|
| WB protocol for GPX4 (Human Specific) antibody 82822-2-RR | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Biochem Pharmacol HDAC inhibitors activate lipid peroxidation and ferroptosis in gastric cancer | ||
Viruses Infectious Spleen and Kidney Necrosis Virus Triggers Ferroptosis in CPB Cells to Enhance Virus Replication | ||
Biomedicines Inhibition of TPI1 Sensitizes Cisplatin-Resistant Oral Cancer to Ferroptosis |





