Tested Applications
| Positive WB detected in | HeLa cells, HEK-293 cells, HepG2 cells, Jurkat cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:2000-1:15000 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
82822-2-RR targets GPX4 (Human Specific) in WB, ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Cited Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Recombinant |
| Type | Antibody |
| Immunogen |
CatNo: Ag30650 Product name: Recombinant human GPX4 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 107-197 aa of BC021567 Sequence: KQEPGSNEEIKEFAAGYNVKFDMFSKICVNGDDAHPLWKWMKIQPKGKGILGNAIKWNFTKFLIDKNGCVVKRYGPMEEPLVIEKDLPHYF Predict reactive species |
| Full Name | glutathione peroxidase 4 (phospholipid hydroperoxidase) |
| Observed Molecular Weight | 20-23 kDa |
| GenBank Accession Number | BC021567 |
| Gene Symbol | GPX4 |
| Gene ID (NCBI) | 2879 |
| RRID | AB_3086547 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein A purification |
| UNIPROT ID | P36969 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
GPX4 (Phospholipid hydroperoxide glutathione peroxidase, mitochondrial) protects cells against membrane lipid peroxidation and cell death. Required for normal sperm development and male fertility.It has two isforms about 20KDa and 22KDa, respectively. GPX4 is a monomer,but it has a tendency to form higher mass oligomers (PMID:17630701).82822-2-RR is human specific.
Protocols
| Product Specific Protocols | |
|---|---|
| WB protocol for GPX4 (Human Specific) antibody 82822-2-RR | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The GPX4 (Human Specific) Recombinant monoclonal antibody (6E9), catalog number 82822-2-RR, has 12 citations published in journals including Advanced Science, Phytomedicine, Redox Reports, Biochemical Pharmacology, International Journal of Molecular Sciences, International Immunopharmacology, Inflammation, Biomedicines, Viruses, Pathological Research and Practice, Molecular Biology Reports, and Biology. Research fields span ferroptosis, lipid peroxidation, cancer (breast, gastric, liver, lung, oral, renal), acute kidney injury, Parkinson's disease, and viral infection.
| Species | Application | Title |
|---|---|---|
Adv Sci (Weinh) Precision-Engineered Silver Single-Atom Carbon Dot Nanozymes for Theranostic Management of Acute Kidney Injury. | ||
Phytomedicine Podophyllotoxin induced renal toxicity by triggering fatty acid oxidation dysfunction and ferroptosis in rats on the basis of the toxicological evidence chain (TEC) concept. | ||
Redox Rep Repurposing nitazoxanide as a novel ferroptosis inducer for triple-negative breast cancer via dual disruption of iron homeostasis and the β-catenin/GPX4 axis. | ||
Biochem Pharmacol HDAC inhibitors activate lipid peroxidation and ferroptosis in gastric cancer | ||
Int Immunopharmacol RAB10 mediates metabolic regulation of ferroptosis in breast Cancer and synergistically remodels the tumour immune microenvironment via macrophage M2 polarization. | ||
Int J Mol Sci HAX1 Promotes Hepatocellular Carcinoma Progression by Inhibiting Ferroptosis Through Modulation of Iron Homeostasis and the GSH/GPX4 Pathway. |
