• Featured Product
  • KD/KO Validated

CoraLite®594-conjugated GLUT1 Monoclonal antibody

GLUT1 Monoclonal Antibody for IF-P, FC (Intra)
Cat No. CL594-66290
Clone No.2A5A2

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse

Applications

IF-P, FC (Intra)

SLC2A1, 2A5A2, GLUT-1, SLC2A1,GLUT1

Formulation:  PBS, Proclin 300, BSA, Glycerol
PBS, Proclin 300, BSA, Glycerol
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IF-P detected inhuman lung cancer tissue
Positive FC (Intra) detected inJurkat cells

Recommended dilution

ApplicationDilution
Immunofluorescence (IF)-PIF-P : 1:50-1:500
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL594-66290 targets GLUT1 in IF-P, FC (Intra) applications and shows reactivity with human, mouse samples.

Tested Reactivity human, mouse
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag17108

Product name: Recombinant human SLC2A1,GLUT1 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 216-280 aa of BC121804

Sequence: INRNEENRAKSVLKKLRGTADVTHDLQEMKEESRQMMREKKVTILELFRSPAYRQPILIAVVLQL

Predict reactive species
Full Name solute carrier family 2 (facilitated glucose transporter), member 1
Calculated Molecular Weight 492 aa, 54 kDa
Observed Molecular Weight 45-55 kDa
GenBank Accession NumberBC121804
Gene Symbol GLUT1
Gene ID (NCBI) 6513
RRIDAB_2934721
Conjugate CoraLite®594 Fluorescent Dye
Excitation/Emission Maxima Wavelengths588 nm / 604 nm
FormLiquid
Purification MethodProtein G purification
UNIPROT IDP11166
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

Glucose transporter 1 (GLUT1), also known as solute carrier family 2, facilitated glucose transporter member 1 (SLC2A1), is a uniporter protein responsible for the transport of glucose in many cell types and across the blood-brain barrier.

What is the molecular weight of GLUT1? Is GLUT1 post-translationally modified?

There are two forms of GLUT1 transporter that differ in their molecular weight. The 45-kDa form is found in glial cells, while the 55-kDa form is present in the endothelial cells regulating glucose transport over the blood-brain and blood-tissue barriers (PMID: 9630522). N-glycosylation of asparagine at position 42 is the only known post-translation modification of GLUT1 (PMID: 3839598).

What is the subcellular localization of GLUT1?

Glucose transporters, including GLUT1, are multiple-pass integral membrane proteins. GLUT1 is present at the plasma membrane but is also a subject of recycling between plasma membrane and endosomes.

What molecules can be transported by GLUT1?

The main substrate of GLUT1 transport is glucose, but it can also transport galactose, mannose, glucosamine, and reduced ascorbate. 

What is the tissue expression pattern of GLUT1?

GLUT1 is expressed by many cell types but the highest levels are observed in erythrocytes and in the central nervous system (astrocytes). GLUT1 is responsible for glucose transfer across the blood-brain and blood-tissue barriers, including placental transport.


Protocols

Product Specific Protocols
FC protocol for CL594 GLUT1 antibody CL594-66290Download protocol
IF protocol for CL594 GLUT1 antibody CL594-66290Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...