• Featured Product
  • KD/KO Validated

GLI1 Monoclonal antibody, PBS Only

GLI1 Monoclonal Antibody for WB, ELISA
Cat No. 66905-1-PBS
Clone No.1D2B2

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse, rat, pig

Applications

WB, ELISA

1D2B2, GLI, GLI family zinc finger 1, Glioma associated oncogene, Glioma-associated oncogene

Formulation:  PBS Only
PBS and Azide
PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

66905-1-PBS targets GLI1 in WB, ELISA applications and shows reactivity with human, mouse, rat, pig samples.

Tested Reactivity human, mouse, rat, pig
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag27832

Product name: Recombinant human GLI1 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 470-659 aa of BC013000

Sequence: NAGGSTEDLSSLDEGPCIAGTGLSTLRRLENLRLDQLHQLRPIGTRGLKLPSLSHTGTTVSRRVGPPVSLERRSSSSSSISSAYTVSRRSSLASPFPPGSPPENGASSLPGLMPAQHYLLRARYASARGGGTSPTAASSLDRIGGLPMPPWRSRAEYPGYNPNAGVTRRASDPAQAADRPAPARVQRFKS

Predict reactive species
Full Name GLI family zinc finger 1
Calculated Molecular Weight 1106 aa, 118 kDa
Observed Molecular Weight 150 kDa
GenBank Accession NumberBC013000
Gene Symbol GLI1
Gene ID (NCBI) 2735
RRIDAB_2882232
Conjugate Unconjugated
FormLiquid
Purification MethodProtein G purification
UNIPROT IDP08151
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

GLI1, also known as Glioma-associated oncogene, is a 1106 amino acid protein, which belongs to the GLI C2H2-type zinc-finger protein family. GLI1 is detected in testis and Also expressed in the brain with highest expression in the cerebellum, optic nerve and olfactory tract. GLI1 is tethered in the cytoplasm by binding to SUFU (PubMed:10806483). GLI1 is activated and translocated to the nucleus promoted by interaction with STK36 (PubMed:10806483). Phosphorylation of GLI1 by ULK3 may promote nuclear localization (PubMed:19878745). GLI1 as a transcriptional activator may regulate the transcription of specific genes during normal development (PubMed:19706761). GLI1 plays a role in craniofacial development and digital development, as well as development of the central nervous system and gastrointestinal tract and Mediates SHH signaling (PubMed:19706761). GLI1 plays a role in cell proliferation and differentiation via its role in SHH signaling.

Loading...
||
New chat Able
正在加载,请稍候...