• Featured Product
  • KD/KO Validated

GLI1 Monoclonal antibody

GLI1 Monoclonal Antibody for WB, ELISA
Cat No. 66905-1-Ig
Clone No.1D2B2

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse, rat, pig

Applications

WB, IHC, IF, IP, CoIP, ELISA

1D2B2, GLI, GLI family zinc finger 1, Glioma associated oncogene, Glioma-associated oncogene

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inA549 cells, C6 cells, HEK-293 cells, human testis tissue, 4T1 cells, mouse brain tissue, NCI-H1299 cells, PC-3 cells, MCF-7 cells, MDA-MB-231 cells, pig brain tissue, rat brain tissue, BxPC-3 cells, U-251 cells, mouse liver tissue, rat liver tissue

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:2000-1:20000
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

66905-1-Ig targets GLI1 in WB, IHC, IF, IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat, pig samples.

Tested Reactivity human, mouse, rat, pig
Cited Reactivityhuman, mouse, rat
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag27832

Product name: Recombinant human GLI1 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 470-659 aa of BC013000

Sequence: NAGGSTEDLSSLDEGPCIAGTGLSTLRRLENLRLDQLHQLRPIGTRGLKLPSLSHTGTTVSRRVGPPVSLERRSSSSSSISSAYTVSRRSSLASPFPPGSPPENGASSLPGLMPAQHYLLRARYASARGGGTSPTAASSLDRIGGLPMPPWRSRAEYPGYNPNAGVTRRASDPAQAADRPAPARVQRFKS

Predict reactive species
Full Name GLI family zinc finger 1
Calculated Molecular Weight 1106 aa, 118 kDa
Observed Molecular Weight 150 kDa
GenBank Accession NumberBC013000
Gene Symbol GLI1
Gene ID (NCBI) 2735
RRIDAB_2882232
Conjugate Unconjugated
FormLiquid
Purification MethodProtein G purification
UNIPROT IDP08151
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

GLI1, also known as Glioma-associated oncogene, is a 1106 amino acid protein, which belongs to the GLI C2H2-type zinc-finger protein family. GLI1 is detected in testis and Also expressed in the brain with highest expression in the cerebellum, optic nerve and olfactory tract. GLI1 is tethered in the cytoplasm by binding to SUFU (PubMed:10806483). GLI1 is activated and translocated to the nucleus promoted by interaction with STK36 (PubMed:10806483). Phosphorylation of GLI1 by ULK3 may promote nuclear localization (PubMed:19878745). GLI1 as a transcriptional activator may regulate the transcription of specific genes during normal development (PubMed:19706761). GLI1 plays a role in craniofacial development and digital development, as well as development of the central nervous system and gastrointestinal tract and Mediates SHH signaling (PubMed:19706761). GLI1 plays a role in cell proliferation and differentiation via its role in SHH signaling.

Protocols

Product Specific Protocols
WB protocol for GLI1 antibody 66905-1-IgDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
mouse,humanWB

Mol Cancer

Circular RNA circIPO11 drives self-renewal of liver cancer initiating cells via Hedgehog signaling.

Authors - Yang Gu
humanWB,IHC

Nat Commun

TSPAN8 promotes cancer cell stemness via activation of sonic Hedgehog signaling.

Authors - Rongxuan Zhu
humanWB

J Exp Clin Cancer Res

ACTN1 promotes HNSCC tumorigenesis and cisplatin resistance by enhancing MYH9-dependent degradation of GSK-3β and integrin β1-mediated phosphorylation of FAK

Authors - Li Cui
mouseWB

J Nanobiotechnology

NaHS@Cy5@MS@SP nanoparticles improve rheumatoid arthritis by inactivating the Hedgehog signaling pathway through sustained and targeted release of H2S into the synovium

Authors - Xue-Xue Zhu
mouseWB

JCI Insight

Mutations in OSBPL2 cause hearing loss associated with primary cilia defects via Sonic Hedgehog signaling.

Authors - Hairong Shi
mouseWB,IF,CoIP

Cancer Immunol Res

Remodeling Chondroitin-6-Sulfate-Mediated Immune Exclusion Enhances Anti-PD-1 Response in Colorectal Cancer with Microsatellite Stability.

Authors - Qijing Wu

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


FH

MALLIKARJUNA (Verified Customer) (10-17-2025)

work best for IHC

  • Applications: Immunohistochemistry
  • Primary Antibody Dilution: 1:1000
  • Cell Tissue Type: mouse tissue
FH

Bárbara (Verified Customer) (07-31-2025)

We tested the GLI1 antibody (Proteintech) for Western blot in human PBMC lysates at 1:1000 dilution. The expected ~140 kDa band low, but with one band

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:1000
  • Cell Tissue Type: PBMCs
FH

Boyan (Verified Customer) (07-23-2019)

In my experiment, I used the untreated and Shh ligand-treated cell lysates, in which the protein level of Gli1 should be increased after Shh treatment.With these two samples, I could detect a significant induction of the Gli1 protein using another Gli1 antibody. But, I could not see this induction with this antibody (66905-1-lg). A tricky thing is that, comparing with the real Gli1 band shown by the other antibody, this antibody (66905-1-lg) could recognise a protein at a similar molecular weight (but a little higher than that real Gli1). I think this is misleading, because although being shown on the website, that band is not the real band of Gli1.

  • Applications: Western Blot,
  • Cell Tissue Type: MEF
FH

Joshua (Verified Customer) (04-28-2019)

Cells paraformaldehyde fixed and stained for GLI1 (red). Counterstained with DRAQ7 (blue). Observed mixed nuclear/cytosolic staining as expected for GLI1.

  • Applications: Immunofluorescence,
  • Primary Antibody Dilution: 1:500
  • Cell Tissue Type: Mouse NIH3T3
GLI1 Antibody Immunofluorescence, validation (1:500 dilution) in Mouse NIH3T3 (Cat no:66905-1-Ig)
Loading...
||
New chat

Able

正在加载,请稍候...