• Featured Product
  • KD/KO Validated

FUS/TLS Monoclonal antibody, PBS Only

FUS/TLS Monoclonal Antibody for WB, IHC, IF-P, IF-Fro, FC (Intra), IP, ELISA
Cat No. 68262-1-PBS
Clone No.1B4F8

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse, rat

Applications

WB, IHC, IF-P, IF-Fro, FC (Intra), IP, ELISA

FUS, 1B4F8, 75 kDa DNA pairing protein, 75 kDa DNA-pairing protein, ALS

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

68262-1-PBS targets FUS/TLS in WB, IHC, IF-P, IF-Fro, FC (Intra), IP, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag2150

Product name: Recombinant human FUS/TLS protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 53-400 aa of BC026062

Sequence: SSYSSYGQSQNTGYGTQSTPQGYGSTGGYGSSQSSQSSYGQQSSYPGYGQQPAPSSTSGSYGSSSQSSSYGQPQSGSYSQQPSYGGQQQSYGQQQSYNPPQGYGQQNQYNSSSGGGGGGGGGGNYGQDQSSMSSGGGSGGGYGNQDQSGGGGSGGYGQQDRGGRGRGGSGGGGGGGGGGYNRSSGGYEPRGRGGGRGGRGGMGGSDRGGFNKFGGPRDQGSRHDSEQDNSDNNTIFVQGLGENVTIESVADYFKQIGIIKTNKKTGQPMINLYTDRETGKLKGEATVSFDDPPSAKAAIDWFDGKEFSGNPIKVSFATRRADFNRGGGNGRGGRGRGGPMGRGGYGGG

Predict reactive species
Full Name fusion (involved in t(12;16) in malignant liposarcoma)
Calculated Molecular Weight 75 kDa
Observed Molecular Weight 53 kDa, 68-75 kDa
GenBank Accession NumberBC026062
Gene Symbol FUS/TLS
Gene ID (NCBI) 2521
Conjugate Unconjugated
FormLiquid
Purification MethodProtein G purification
UNIPROT IDP35637
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

FUS (also named TLS and POMp75) belongs to the RRM TET family. FUS may play a role in the maintenance of genomic integrity; it binds both single-stranded and double-stranded DNA and promotes ATP-independent annealing of complementary single-stranded DNAs and D-loop formation in superhelical double-stranded DNA. FUS is also an RNA-binding protein, and its links to neurodegenerative disease proffer the intriguing possibility that altered RNA metabolism or RNA processing may underlie or contribute to neuron degeneration[PMID: 22640227]. FUS may be a cause of angiomatoid fibrous histiocytoma (AFH) and is implicated in certain forms of amyotrophic lateral sclerosis (ALS) and frontotemporal dementias (FTDs) such as frontotemporal lobar dementia with ubiquitin inclusions (FTLD-U)(PMID: 22640227). Multiple phosphorylation on the N terminus of FUS caused that FUS was detected 68-75 kDa (PMID:24899704).

Loading...
||
New chat

Able

正在加载,请稍候...