EPB41L3 Recombinant monoclonal antibody, PBS Only

• 

  WB analysis of U2OS using 83275-2-RR (same clone as 83275-2-PBS)

  U2OS cells were subjected to SDS PAGE followed by western blot with 83275-2-RR (EPB41L3 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 83275-2-PBS in a different storage buffer formulation.

• 

  WB analysis of U2OS using 83275-2-RR (same clone as 83275-2-PBS)

  WB result of EPB41L3 antibody (83275-2-RR; 1:3000; incubated at room temperature for 1.5 hours) with sh-Control and sh-EPB41L3 transfected U2OS cells. This data was developed using the same antibody clone with 83275-2-PBS in a different storage buffer formulation.

• 

  FC experiment of U2OS using 83275-2-RR (same clone as 83275-2-PBS)

  1x10^6 U2OS cells were intracellularly stained with 0.25 ug EPB41L3 Recombinant antibody (83275-2-RR, Clone:230501D7) and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2)(red), or 0.25 ug Control Antibody (blue). Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer. This data was developed using the same antibody clone with 83275-2-PBS in a different storage buffer formulation.

• 

  Affinity and Kinetic Characterization of 83275-2-RR

  Biolayer interferometry (BLl) kinetic assays of 83275-2-RR against Human EPB41L3 were performed. The affinity constant is below 1 pM.

• Featured Product
• KD/KO Validated

EPB41L3 Uni-rAb^® Recombinant Antibody for WB, FC (Intra), Indirect ELISA

Cat No. 83275-2-PBS

Clone No.230501D7

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, FC (Intra), Indirect ELISA

Synonyms

230501D7, 4.1B, Band 4.1-like protein 3, Band 4.1-like protein 3, N-terminally processed, DAL1

---

Product Information

83275-2-PBS targets EPB41L3 in WB, FC (Intra), Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag1089

  Product name: Recombinant human EPB41L3 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 191-312 aa of BC008377

  Sequence: MQCKVILLDGSEYTCDVEKRSRGQVLFDKVCEHLNLLEKDYFGLTYRDAENQKNWLDPAKEIKKQVRSGAWHFSFNVKFYPPDPAQLSEDITRYYLCLQLRDDIVSGRLPCSFVTLALLGS

• Full Name: erythrocyte membrane protein band 4.1-like 3
• Calculated Molecular Weight: 121 kDa
• Observed Molecular Weight: 120-130 kDa
• GenBank Accession Number: BC008377
• Gene Symbol: EPB41L3
• Gene ID (NCBI): 23136
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purfication
• UNIPROT ID: Q9Y2J2
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

EPB41L3, also known as 4.1B and DAL1, belongs to the protein 4.1 family. It is a tumor suppressor that inhibits cell proliferation and promotes apoptosis. EPB41L3 modulates the activity of protein arginine N-methyltransferases, including PRMT3 and PRMT5 (PMID: 15334060, 15737618). DAL1 loss is an early event in meningioma tumorigenesis (PMID: 10888600).