EEA1 Monoclonal antibody, PBS Only

• 

  WB analysis of HepG2 using 68065-1-Ig (same clone as 68065-1-PBS)

  WB result of EEA1 antibody (68065-1-Ig; 1:3000; incubated at room temperature for 1.5 hours) with sh-Control and sh-EEA1 transfected HepG2 cells. This data was developed using the same antibody clone with 68065-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 68065-1-Ig (same clone as 68065-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 68065-1-Ig (EEA1 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 68065-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse brain using 68065-1-Ig (same clone as 68065-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 68065-1-Ig (EEA1 antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 68065-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse brain using 68065-1-Ig (same clone as 68065-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 68065-1-Ig (EEA1 antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 68065-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HepG2 using 68065-1-Ig (same clone as 68065-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed HepG2 cells using EEA1 antibody (68065-1-Ig, Clone: 1E11E4 ) at dilution of 1:3000 and CoraLite®488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L), CL594-Phalloidin (red). This data was developed using the same antibody clone with 68065-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HeLa using 68065-1-Ig (same clone as 68065-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed HeLa cells using EEA1 antibody (68065-1-Ig, Clone: 1E11E4 ) at dilution of 1:400 and CoraLite®488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L), CL594-phalloidin (red). This data was developed using the same antibody clone with 68065-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

EEA1 Monoclonal Antibody for WB, IHC, IF/ICC, Indirect ELISA

Cat No. 68065-1-PBS

Clone No.1E11E4

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, Indirect ELISA

Synonyms

1E11E4, Early endosome antigen 1, Endosome-associated protein p162, MST105, MSTP105

---

Product Information

68065-1-PBS targets EEA1 in WB, IHC, IF/ICC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag28814

  Product name: Recombinant human EEA1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1151-1350 aa of NM_003566

  Sequence: KLESIKEITNLKDAKQLLIQQKLELQGKADSLKAAVEQEKRNQQILKDQVKKEEEELKKEFIEKEAKLHSEIKEKEVGMKKHEENEAKLTMQITALNENLGTVKKEWQSSQRRVSELEKQTDDLRGEIAVLEATVQNNQDERRALLERCLKGEGEIEKLQTKVLELQRKLDNTTAAVQELGRENQSLQIKHTQALNRKWA

• Full Name: early endosome antigen 1
• Calculated Molecular Weight: 162 kDa
• Observed Molecular Weight: 162 kDa
• GenBank Accession Number: NM_003566
• Gene Symbol: EEA1
• Gene ID (NCBI): 8411
• RRID: AB_2918806
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q15075
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Early endosome antigen 1 (EEA1) is a marker of early endosomes and has an important role in endosomal trafficking. EEA1 contains coiled-coil regions and an FYVE-type zinc finger which interacts with phosphatidylinositol-3-phosphate. EEA1 functions as a Rab5 effector, mediates endosome docking and, together with SNAREs, leads to membrane fusion.