CoraLite® Plus 488-conjugated Cytokeratin 7 Polyclonal antibody

• 

  IF Staining of human breast cancer using CL488-15539

  Immunofluorescent analysis of (4% PFA) fixed human breast cancer tissue using CoraLite® Plus 488 Cytokeratin 7 antibody (CL488-15539) at dilution of 1:400, CoraLite® Plus 647 smooth muscle actin specific antibody (CL647-67735, Clone: 1E9A11, red), CoraLite®594 CD31 antibody (CL594-11265, red).

• 

  IF Staining of human breast cancer using CL488-15539

  Immunofluorescent analysis of (4% PFA) fixed human breast cancer tissue using CoraLite® Plus 488 Cytokeratin 7 antibody (CL488-15539) at dilution of 1:400, CoraLite® Plus 647 smooth muscle actin specific antibody (CL647-67735, Clone: 1E9A11, red), CoraLite®594 CD31 antibody (CL594-11265, red).

• 

  IF Staining of human breast cancer using CL488-15539

  Immunofluorescent analysis of (4% PFA) fixed human breast cancer tissue using CoraLite® Plus 488 Cytokeratin 7 antibody (CL488-15539) at dilution of 1:400, CoraLite® Plus 647 smooth muscle actin specific antibody (CL647-67735, Clone: 1E9A11, red), CoraLite®594 CD31 antibody (CL594-11265, red).

• 

  IF Staining of HeLa using CL488-15539

  Immunofluorescent analysis of (-20°C Methanol) fixed HeLa cells using CoraLite® Plus 488 Cytokeratin 7 antibody (CL488-15539) at dilution of 1:200.

• 

  IF Staining of HeLa using CL488-15539

  Immunofluorescent analysis of (-20°C Ethanol) fixed HeLa cells using CoraLite® Plus 488 Cytokeratin 7 antibody (CL488-15539) at dilution of 1:200.

• 

  FC experiment of HeLa using CL488-15539

  (blue)1x10^6 HeLa cells were intracellularly stained with 0.8 ug CoraLite® Plus 488 Anti-Human Cytokeratin 7 (CL488-15539)(red), or 0.8 ug Isotype Control. Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer (PF00011-C).

Cytokeratin 7 Polyclonal Antibody for IF/ICC, IF-P, FC (Intra)

Cat No. CL488-15539

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

IF/ICC, IF-P, FC (Intra)

Synonyms

KRT7, keratin 7, Cytokeratin-7, Cytokeratin,Keratin, CK-7

---

Tested Applications

• Positive IF-P detected in: human breast cancer tissue
• Positive IF/ICC detected in: HeLa cells
• Positive FC (Intra) detected in: HeLa cells

Recommended dilution

• Immunofluorescence (IF)-P: IF-P : 1:200-1:800
• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500
• Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.80 ug per 10^6 cells in a 100 µl suspension

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

CL488-15539 targets Cytokeratin 7 in IF/ICC, IF-P, FC (Intra) applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag7895

  Product name: Recombinant human CK7 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-351 aa of BC002700

  Sequence: MSIHFSSPVFTSRSAAFSGRGAQVRLSSARPGGLGSSSLYGLGASRPRVAVRSAYGGPVGAGIREVTINQSLLAPLRLDADPSLQRVRQEESEQIKTLNNKFASFIDKVRFLEQQNKLLETKWTLLQEQKSAKSSRLPDIFEAQIAGLRGQLEALQVDGGRLEAELRSMQDVVEDFKNKYEDEINRRTAAENEFVVLKKDVDAAYMSKVELEAKVDALNDEINFLRTLNETELTELQSQISDTSVVLSMDNSRSLDLDGIIAEVKAQYEEMAKCSRAEAEAWYQTKFETLQAQAGKHGDDLRNTRNEISEMNRAIQRLQAEIDNIKNQRAKLEAAIAEAEERGELALKDAR

• Full Name: keratin 7
• Calculated Molecular Weight: 469 aa, 51 kDa
• Observed Molecular Weight: 51 kDa
• GenBank Accession Number: BC002700
• Gene Symbol: Cytokeratin 7
• Gene ID (NCBI): 3855
• RRID: AB_2919119
• Conjugate: CoraLite® Plus 488 Fluorescent Dye
• Excitation/Emission Maxima Wavelengths: 493 nm / 522 nm
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P08729
• Storage Buffer: PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
• Storage Conditions: Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage.

Background Information

Keratins are a large family of proteins that form the intermediate filament cytoskeleton of epithelial cells, which are classified into two major sequence types. Type I keratins are a group of acidic intermediate filament proteins, including K9-K23, and the hair keratins Ha1-Ha8. Type II keratins are the basic or neutral courterparts to the acidic type I keratins, including K1-K8, and the hair keratins, Hb1-Hb6. KRT7 is a type II keratin. It is specifically expressed in the simple epithelia lining the cavities of the internal organs and in the gland ducts and blood vessels.