Cytochrome c Monoclonal antibody, PBS Only

• 

  WB analysis using 66264-1-Ig (same clone as 66264-1-PBS)

  Various cells were subjected to SDS PAGE followed by western blot with 66264-1-Ig (Cytochrome c antibody) at dilution of 1:20000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 66264-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HepG2 using 66264-1-Ig (same clone as 66264-1-PBS)

  WB result of Cytochrome c antibody (66264-1-Ig; 1:1000; incubated at room temperature for 1.5 hours) with sh-Control and sh-Cytochrome c transfected HepG2 cells. This data was developed using the same antibody clone with 66264-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HEK-293 using 66264-1-Ig (same clone as 66264-1-PBS)

  HEK-293 cells and HEK-293-derived exosomes (HEK-293-exo) were subjected to SDS PAGE followed by western blot with 66264-1-Ig (Cytochrome c antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 66264-1-PBS in a different storage buffer formulation.

• 

  WB analysis of human heart using 66264-1-Ig (same clone as 66264-1-PBS)

  human heart tissue were subjected to SDS PAGE followed by western blot with 66264-1-Ig (Cytochrome c Antibody) at dilution of 1:8000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 66264-1-PBS in a different storage buffer formulation.

• 

  WB analysis of human skeletal muscle using 66264-1-Ig (same clone as 66264-1-PBS)

  human skeletal muscle tissue were subjected to SDS PAGE followed by western blot with 66264-1-Ig (Cytochrome c Antibody) at dilution of 1:16000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 66264-1-PBS in a different storage buffer formulation.

• 

  WB analysis of rat skeletal muscle using 66264-1-Ig (same clone as 66264-1-PBS)

  rat skeletal muscle tissue were subjected to SDS PAGE followed by western blot with 66264-1-Ig (Cytochrome c Antibody) at dilution of 1:40000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 66264-1-PBS in a different storage buffer formulation.

• 

  WB analysis of mouse skeletal muscle using 66264-1-Ig (same clone as 66264-1-PBS)

  mouse skeletal muscle tissue were subjected to SDS PAGE followed by western blot with 66264-1-Ig (Cytochrome c Antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 66264-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human liver cancer using 66264-1-Ig (same clone as 66264-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 66264-1-Ig (Cytochrome c antibody) at dilution of 1:2000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 66264-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human breast cancer using 66264-1-Ig (same clone as 66264-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 66264-1-Ig (Cytochrome c antibody) at dilution of 1:5000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 66264-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human breast cancer using 66264-1-Ig (same clone as 66264-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 66264-1-Ig (Cytochrome c antibody) at dilution of 1:5000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 66264-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human liver cancer using 66264-1-Ig (same clone as 66264-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 66264-1-Ig (Cytochrome c antibody) at dilution of 1:2000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 66264-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human breast cancer using 66264-1-Ig (same clone as 66264-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 66264-1-Ig (Cytochrome c antibody) at dilution of 1:5000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 66264-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human breast cancer using 66264-1-Ig (same clone as 66264-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 66264-1-Ig (Cytochrome c antibody) at dilution of 1:5000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 66264-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HepG2 using 66264-1-Ig (same clone as 66264-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed HepG2 cells using Cytochrome c antibody (66264-1-Ig, Clone: 2D8D11 ) at dilution of 1:400 and CoraLite®488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L) (SA00013-1), CL594-phalloidin (red). This data was developed using the same antibody clone with 66264-1-PBS in a different storage buffer formulation.

• 

  FC experiment of HepG2 using 66264-1-Ig (same clone as 66264-1-PBS)

  1X10^6 HepG2 cells were intracellularly stained with 0.2 ug Anti-Human Cytochrome c (66264-1-Ig, Clone:2D8D11) and CoraLite®488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L) at dilution 1:1000 (green), and 0.2 ug Mouse IgG2a Isotype Control (66360-2-Ig, Clone: K11A1B2A2) (black). Cells were fixed with 4% PFA and permeabilized with 0.1% TritonX-100. This data was developed using the same antibody clone with 66264-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

Cytochrome c Monoclonal Antibody for WB, IHC, IF/ICC, FC (Intra), Indirect ELISA

Cat No. 66264-1-PBS

Clone No.2D8D11

Host / Isotype

Mouse / IgG2a

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, FC (Intra), Indirect ELISA

Synonyms

CYCS, CYC, 2D8D11

---

Product Information

66264-1-PBS targets Cytochrome c in WB, IHC, IF/ICC, FC (Intra), Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Mouse / IgG2a
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag24349

  Product name: Recombinant human Cytochrome c protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-105 aa of BC009578

  Sequence: MGDVEKGKKIFIMKCSQCHTVEKGGKHKTGPNLHGLFGRKTGQAPGYSYTAANKNKGIIWGEDTLMEYLENPKKYIPGTKMIFVGIKKKEERADLIAYLKKATNE

• Full Name: cytochrome c, somatic
• Calculated Molecular Weight: 12 kDa
• Observed Molecular Weight: 12-15 kDa
• GenBank Accession Number: BC009578
• Gene Symbol: Cytochrome c
• Gene ID (NCBI): 54205
• RRID: AB_2716798
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P99999
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Cytochrome c is a 12-15 kDa electron transporting protein located in the inner mitochondrial membrane. Upon apoptotic stimulation, cytochrome c can be released from mitochondria into cytoplasm, resulting in caspase-3 activation and apoptosis. Measurement of cytochrome c release from the mitochondria is useful for detection of the onset of apoptosis in cells. In addition, cytochrome c can also leave cells and be detectable in extra-cellular medium of apoptotic cells and serum of cancer patients. The level of serum cytochrome c may serve as a prognostic maker during cancer therapy.