Cytochrome c Monoclonal antibody

• 

  WB analysis using 66264-1-Ig

  Various cells were subjected to SDS PAGE followed by western blot with 66264-1-Ig (Cytochrome c antibody) at dilution of 1:20000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HepG2 using 66264-1-Ig

  WB result of Cytochrome c antibody (66264-1-Ig; 1:1000; incubated at room temperature for 1.5 hours) with sh-Control and sh-Cytochrome c transfected HepG2 cells.

• 

  WB analysis of HEK-293 using 66264-1-Ig

  HEK-293 cells and HEK-293-derived exosomes (HEK-293-exo) were subjected to SDS PAGE followed by western blot with 66264-1-Ig (Cytochrome c antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of human heart using 66264-1-Ig

  human heart tissue were subjected to SDS PAGE followed by western blot with 66264-1-Ig (Cytochrome c Antibody) at dilution of 1:8000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of human skeletal muscle using 66264-1-Ig

  human skeletal muscle tissue were subjected to SDS PAGE followed by western blot with 66264-1-Ig (Cytochrome c Antibody) at dilution of 1:16000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of rat skeletal muscle using 66264-1-Ig

  rat skeletal muscle tissue were subjected to SDS PAGE followed by western blot with 66264-1-Ig (Cytochrome c Antibody) at dilution of 1:40000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of mouse skeletal muscle using 66264-1-Ig

  mouse skeletal muscle tissue were subjected to SDS PAGE followed by western blot with 66264-1-Ig (Cytochrome c Antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human liver cancer using 66264-1-Ig

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 66264-1-Ig (Cytochrome c antibody) at dilution of 1:2000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human breast cancer using 66264-1-Ig

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 66264-1-Ig (Cytochrome c antibody) at dilution of 1:5000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human breast cancer using 66264-1-Ig

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 66264-1-Ig (Cytochrome c antibody) at dilution of 1:5000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human liver cancer using 66264-1-Ig

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 66264-1-Ig (Cytochrome c antibody) at dilution of 1:2000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human breast cancer using 66264-1-Ig

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 66264-1-Ig (Cytochrome c antibody) at dilution of 1:5000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human breast cancer using 66264-1-Ig

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 66264-1-Ig (Cytochrome c antibody) at dilution of 1:5000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of HepG2 using 66264-1-Ig

  Immunofluorescent analysis of (4% PFA) fixed HepG2 cells using Cytochrome c antibody (66264-1-Ig, Clone: 2D8D11 ) at dilution of 1:400 and CoraLite®488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L) (SA00013-1), CL594-phalloidin (red).

• 

  FC experiment of HepG2 using 66264-1-Ig

  1X10^6 HepG2 cells were intracellularly stained with 0.2 ug Anti-Human Cytochrome c (66264-1-Ig, Clone:2D8D11) and CoraLite®488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L) at dilution 1:1000 (green), and 0.2 ug Mouse IgG2a Isotype Control (66360-2-Ig, Clone: K11A1B2A2) (black). Cells were fixed with 4% PFA and permeabilized with 0.1% TritonX-100.

• Featured Product
• KD/KO Validated

Cytochrome c Monoclonal Antibody for WB, IHC, IF/ICC, FC (Intra), ELISA

Cat No. 66264-1-Ig

Clone No.2D8D11

Publications(139)

Reviews (1)

Host / Isotype

Mouse / IgG2a

Reactivity

human, mouse, rat and More (1)

Applications

WB, IHC, IF/ICC, FC (Intra), ELISA

Synonyms

CYCS, CYC, 2D8D11

---

Tested Applications

• Positive WB detected in: HeLa cells, human heart tissue, human skeletal muscle tissue, rat skeletal muscle tissue, mouse skeletal muscle tissue, HEK-293 cells, HepG2 cells, MCF-7 cells, Jurkat cells, HSC-T6 cells, ROS1728 cells, RAW 264.7 cells
• Positive IHC detected in: human liver cancer tissue, human breast cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: HepG2 cells
• Positive FC (Intra) detected in: HepG2 cells

Recommended dilution

• Western Blot (WB): WB : 1:5000-1:50000
• Immunohistochemistry (IHC): IHC : 1:1000-1:5000
• Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800
• Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.20 ug per 10^6 cells in a 100 µl suspension

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 123 publications below
• IHC: See 3 publications below
• IF: See 17 publications below

Product Information

66264-1-Ig targets Cytochrome c in WB, IHC, IF/ICC, FC (Intra), ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse, rat, canine
• Host / Isotype: Mouse / IgG2a
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag24349

  Product name: Recombinant human Cytochrome c protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-105 aa of BC009578

  Sequence: MGDVEKGKKIFIMKCSQCHTVEKGGKHKTGPNLHGLFGRKTGQAPGYSYTAANKNKGIIWGEDTLMEYLENPKKYIPGTKMIFVGIKKKEERADLIAYLKKATNE

• Full Name: cytochrome c, somatic
• Calculated Molecular Weight: 12 kDa
• Observed Molecular Weight: 12-15 kDa
• GenBank Accession Number: BC009578
• Gene Symbol: Cytochrome c
• Gene ID (NCBI): 54205
• RRID: AB_2716798
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P99999
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Cytochrome c is a 12-15 kDa electron transporting protein located in the inner mitochondrial membrane. Upon apoptotic stimulation, cytochrome c can be released from mitochondria into cytoplasm, resulting in caspase-3 activation and apoptosis. Measurement of cytochrome c release from the mitochondria is useful for detection of the onset of apoptosis in cells. In addition, cytochrome c can also leave cells and be detectable in extra-cellular medium of apoptotic cells and serum of cancer patients. The level of serum cytochrome c may serve as a prognostic maker during cancer therapy.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human,mouse	WB	Hepatology; Hepatic stimulator substance resists hepatic ischemia/reperfusion injury by regulating Drp1 translocation and activation.; Authors - Chao Zhang
human		Cell Death Differ; ZNF451 collaborates with RNF8 to regulate RNF168 localization and amplify ubiquitination signaling to promote DNA damage repair and regulate radiosensitivity; Authors - Feng Xu
human	IF	Nat Commun; Endonuclease G promotes autophagy by suppressing mTOR signaling and activating the DNA damage response.; Authors - Wenjun Wang
human	WB	Redox Biol; Mecheliolide elicits ROS-mediated ERS driven immunogenic cell death in hepatocellular carcinoma.; Authors - Zhongren Xu
human	WB	ACS Appl Mater Interfaces; Extracellular Matrix-Mimicking Hydrogel with Angiogenic and Immunomodulatory Properties Accelerates Healing of Diabetic Wounds by Promoting Autophagy; Authors - Yujie Pan
human	IF	J. Pineal Res.; Human transporters, PEPT1/2, facilitate melatonin transportation into mitochondria of cancer cells: an implication of the therapeutic potential.; Authors - Xiaokui Huo

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.

---

FH

Megha (Verified Customer) (07-10-2018)

• Applications: Western Blot,
• Primary Antibody Dilution: 1:1000
• Cell Tissue Type: Capan-1 cells