• Featured Product
  • KD/KO Validated

Cyclin D1 Monoclonal antibody, PBS Only

Cyclin D1 Monoclonal Antibody for WB, FC (Intra), ELISA
Cat No. 60186-1-PBS
Clone No.2G3G5

Host / Isotype

Mouse / IgG2b

Reactivity

human, mouse, rat

Applications

WB, FC (Intra), ELISA

CCND1, 2G3G5, B cell lymphoma 1 protein, B-cell lymphoma 1 protein, BCL-1

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

60186-1-PBS targets Cyclin D1 in WB, FC (Intra), ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Mouse / IgG2b
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag0689

Product name: Recombinant human Cyclin D1 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 65-245 aa of BC000076

Sequence: LEVCEEQKCEEEVFPLAMNYLDRFLSLEPVKKSRLQLLGATCMFVASKMKETIPLTAEKLCIYTDNSIRPEELLQMELLLVNKLKWNLAAMTPHDFIEHFLSKMPEAEENKQIIRKHAQTFVALCATDVKFISNPPSMVAAGSVVAAVQGLNLRSPNNFLSYYRLTRFLSRVIKCDPDCLR

Predict reactive species
Full Name cyclin D1
Calculated Molecular Weight 295 aa, 34 kDa
Observed Molecular Weight 34 kDa
GenBank Accession NumberBC000076
Gene Symbol Cyclin D1
Gene ID (NCBI) 595
RRIDAB_10793718
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP24385
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

CCND1 (cyclin D1), also known as PRAD1 or BCL1, belongs to the highly conserved cyclin family, whose members are characterized by a dramatic periodicity in protein abundance throughout the cell cycle. CCND1 forms a complex with and functions as a regulatory subunit of CDK4 or CDK6, whose activity is required for cell cycle G1/S transition. The CCND1 gene, located on 11q13 has been reported to be overexpressed in mantle cell lymphoma (MCL) due to the chromosomal translocation. CCND1 has been shown to interact with tumor suppressor protein Rb and the expression of this gene is regulated positively by Rb. Over-expression of CCND1 is known to correlate with the early onset of cancer and risk of tumor progression and metastasis.

Loading...
||
New chat

Able

正在加载,请稍候...