Mouse Cxcl15 Recombinant monoclonal antibody, PBS Only

• 

  WB analysis of mouse lung using 83245-1-RR (same clone as 83245-1-PBS)

  mouse lung tissue were subjected to SDS PAGE followed by western blot with 83245-1-RR (Cxcl15 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 83245-1-PBS in a different storage buffer formulation.

• 

  Affinity and Kinetic Characterization of 83245-1-RR

  Biolayer interferometry (BLl) kinetic assays of 83245-1-RR against Mouse Cxcl15 were performed. The affinity constant is 0.101 nM.

Cxcl15 Uni-rAb^® Recombinant Antibody for WB, Cytometric bead array, Indirect ELISA

Cat No. 83245-1-PBS

Clone No.240163A6

Host / Isotype

Rabbit / IgG

Reactivity

mouse

Applications

WB, Cytometric bead array, Indirect ELISA

Synonyms

240163A6, chemokine (C X C motif) ligand 15, C-X-C motif chemokine 15, Cxcl-15, Scyb15

---

Product Information

83245-1-PBS targets Cxcl15 in WB, Cytometric bead array, Indirect ELISA applications and shows reactivity with mouse samples.

• Tested Reactivity: mouse
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag33964

  Product name: Recombinant mouse Cxcl15 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 26-127 aa of BC061138

  Sequence: QELRCLCIQEHSEFIPLKLIKNIMVIFETIYCNRKEVIAVPKNGSMICLDPDAPWVKATVGPITNRFLPEDLKQKEFPPAMKLLYSVEHEKPLYLSFGRPENKRIFPFPIRETSRHFADLAHNSDRNFLRDSSEVSLTGSDA

• Full Name: chemokine (C-X-C motif) ligand 15
• Calculated Molecular Weight: 19 kDa
• GenBank Accession Number: BC061138
• Gene Symbol: Cxcl15
• Gene ID (NCBI): 20309
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q9WVL7
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.