Use Able AI chat for product recommendations

CD68 Polyclonal antibody

CD68 Polyclonal Antibody for WB, IHC, IF-P, ELISA

Cat No. 28058-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

mouse, rat and More (3)

Applications

WB, IHC, IF-P, ELISA

CD68 antigen, gp110, Scard1

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
CoraLite® Plus 488
Size/Concentration: 
SKU: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inRAW 264.7 cells, mouse spleen tissue, NR8383 cells
Positive IHC detected inmouse spleen tissue, mouse liver tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF-P detected inhuman tonsillitis tissue

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:600-1:2000
Immunohistochemistry (IHC)IHC : 1:1000-1:4000
Immunofluorescence (IF)-PIF-P : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

28058-1-AP targets CD68 in WB, IHC, IF-P, ELISA applications and shows reactivity with mouse, rat samples.

Tested Reactivity mouse, rat
Cited Reactivitymouse, rat, pig, canine, sheep
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag27827

Product name: Recombinant mouse Cd68 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 119-291 aa of NM_001291058

Sequence: MPSPRSKGALGNYTWANGSQPCVQLQAQIQIRILYPIQGGRKAWGISVLNPNKTKVQGGCDGTHPHLSLSFPYGQLTFGFKQDLHQSPSTVYLDYMAVEYNVSFPQAAQWTFMAQNSSLRELQAPLGQSFCCGNASIVLSPAVHLDLLSLRLQAAQLPDKGHFGPCFSCNRDQS

Predict reactive species
Full Name CD68 antigen
Calculated Molecular Weight 35 kDa
Observed Molecular Weight 100 kDa
GenBank Accession NumberNM_001291058
Gene Symbol Cd68
Gene ID (NCBI) 12514
RRIDAB_2881049
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDP31996
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Mouse CD68 (also known as macrosialin) is a type I transmembrane glycoprotein that is highly and specifically expressed by mouse tissue macrophages, and to a lesser extent by dendritic cells. It belongs to the lysosomal/endosomal-associated membrane glycoprotein (LAMP) family and primarily localizes to lysosomes and endosomes with a smaller fraction circulating to the cell surface. CD68 is also a member of the scavenger receptor family. It may play a role in phagocytic activities of tissue macrophages. Due to heavy glycosylation, the apparent molecular mass of CD68 detected by Western blot is generally observed between 80 and 140 kDa, far exceeding its unmodified core protein weight of ~34-37 kDa.

Protocols

Product Specific Protocols
IF protocol for CD68 antibody 28058-1-APDownload protocol
IHC protocol for CD68 antibody 28058-1-APDownload protocol
WB protocol for CD68 antibody 28058-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

What published studies show

SpeciesApplicationTitle
pigIF

Nature

Injectable ultrasonic sensor for wireless monitoring of intracranial signals

Authors - Hanchuan Tang
WB,IF

Signal Transduct Target Ther

C/EBPβ activation in vascular smooth muscle cells promotes hyperlipidemia-induced phenotypic transition and arterial stiffness

Authors - Jun Ma
mouseIF

Nat Aging

Activation of AMPK by GLP-1R agonists mitigates Alzheimer-related phenotypes in transgenic mice

Authors - Yun Zhang
mouseIHC

Crit Care

Recombinant ACE2 protein protects against acute lung injury induced by SARS-CoV-2 spike RBD protein.

Authors - Lingbing Zhang
mouseIF

ACS Nano

Inflammation and Acinar Cell Dual-Targeting Nanomedicines for Synergistic Treatment of Acute Pancreatitis via Ca2+ Homeostasis Regulation and Pancreas Autodigestion Inhibition

Authors - Yanan Wang
WB

ACS Nano

Biomimetic Ginsenoside Rb1 and Probucol Co-Assembled Nanoparticles for Targeted Atherosclerosis Therapy via Inhibition of Oxidative Stress, Inflammation, and Lipid Deposition

Authors - Jieying Zeng

Reviews

    5.0 out of 5
Add a review

3 verified customer reviews

What customers say

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


Mounika (Verified Customer) (01-08-2026)

Bands are very bright and cells under confocal microscope are very beautiful!

  • Applications: Western Blot, Immunohistochemistry, Immunofluorescence
  • Primary Antibody Dilution: 1:800

Alexandru (Verified Customer) (11-13-2023)

Great antibody, worked well in my experiments.

  • Applications: Immunofluorescence
  • Cell Tissue Type: Mouse ventricle

Amelie (Verified Customer) (09-09-2019)

sections were deparaffinized and subjected to heat mediated antigen retrieval using TE buffer ph9On the pictures CD68 in red

  • Applications: Immunofluorescence,
  • Primary Antibody Dilution: 1:1000
  • Cell Tissue Type: mouse adrenal gland
CD68 Antibody Immunofluorescence, validation (1:1000 dilution) in mouse adrenal gland (Cat no:28058-1-AP)
Loading...
||
New chat

Able

正在加载,请稍候...